KEGG   Homo sapiens (human): 390155Help
Entry
390155            CDS       T01001                                 

Gene name
OR5T1, OR11-179, OR5T1P
Definition
(RefSeq) olfactory receptor family 5 subfamily T member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390155 (OR5T1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390155 (OR5T1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390155
NCBI-ProteinID: NP_001004745
HGNC: 14821
Ensembl: ENSG00000181698
Vega: OTTHUMG00000166853
Pharos: Q8NG75(Tdark)
UniProt: Q8NG75 A0A126GVL6
Position
11q12.1
AA seq 326 aa AA seqDB search
MSGLPSDMDLYKLQLNNFTEVTMFILISFTEEFDVQVFLFLLFLAIYLFTLIGNLGLVVP
IIGDFWLHSPMYYFLGVLSFLDVCYSTVVTPKMLVNFLAKNKSISFLGCATQMFLACTFG
TTECFLLAAMAYDRYVAIYNPLLYSVSMSPRVYVPLITASYVASILHATIHTVATFSLSF
CGSNEIRHVFCNMPPLLAISCSDTHVIQLLFFYFVGSIEIVTILIVLISYGFILLAILKM
QSAEGRRKVFSTCGAHLTGVTIYHGTILFMYVRPSSSYTSDNDMIVSIFYTIVIPMLNPI
IYSLRNKDVKEAIKRLLVRNWFINKL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggttgccttcagatatggatctatacaagcttcaattaaacaattttactgaa
gtcaccatgtttatattaataagcttcacagaagaatttgatgtgcaagtcttcctattt
ttattatttttagcaatctatctattcactctaataggcaatttagggctggttgtaccg
atcattggggatttctggcttcacagcccaatgtactattttcttggtgttttatcattc
ttggatgtctgctattctacagttgtcactccaaaaatgttggtcaatttcctggcaaaa
aataaatctatttcatttcttggatgtgcaacacagatgtttcttgcttgtacttttgga
accacagaatgctttctcttggctgcaatggcttatgatcgctatgtagccatctacaac
cctctcctgtattcagtgagcatgtcacccagagtctatgtgccactcatcactgcttcc
tatgttgctagcattttacatgctactatacatacagtggctacatttagcctgtccttc
tgtggatccaatgaaattaggcatgtcttttgtaatatgcctcctctgcttgctatttct
tgttctgacactcacgtaatccagcttctattcttctactttgtgggctctattgagata
gtcactatcctgattgtcctgatctcctatggttttattctgttggccattctgaagatg
cagtctgctgaagggaggagaaaagtcttctctacatgtggagctcacctaactggagtg
acaatttatcatgggacaatcctcttcatgtatgtgagaccaagttccagctacacttcg
gacaatgacatgatagtgtcaatattttataccattgtgattcccatgctgaatcccatc
atctacagtttgcggaacaaagatgtaaaggaggcaatcaaaagattgcttgtgagaaat
tggttcataaataagttatag

DBGET integrated database retrieval system