KEGG   Homo sapiens (human): 390162Help
Entry
390162            CDS       T01001                                 

Gene name
OR5M9, OR11-190
Definition
(RefSeq) olfactory receptor family 5 subfamily M member 9
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390162 (OR5M9)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390162 (OR5M9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390162
NCBI-ProteinID: NP_001004743
HGNC: 15294
Ensembl: ENSG00000150269
Vega: OTTHUMG00000166874
Pharos: Q8NGP3(Tdark)
UniProt: Q8NGP3 A0A126GVK6
Position
11q12.1
AA seq 310 aa AA seqDB search
MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISISPQLQSPMYFF
LSHLSFADVCFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIAVVHVEVYILAVMAFDR
YMAGCNPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADP
PLIQIACGRVHIKEITMIVIAGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCG
SHLTAVSMFYGTPIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVN
KAITKTYVRQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatttcacggatgtgacagaatttactctcctggggctgacctgtcgtcaggag
ctacaggttctcttttttgtggtgttcctagcggtttacatgatcactctgttgggaaat
attggtatgatcattttgattagcatcagtcctcagcttcagagtcccatgtactttttc
ctgagtcatctgtcttttgcggacgtgtgcttctcctccaacgttacccccaaaatgctg
gaaaacttattatcagagacaaaaaccatttcctatgtgggatgcttggtgcagtgctac
tttttcattgccgttgtccacgtggaggtctatatcctggctgtgatggcctttgacagg
tacatggccggctgcaaccctctgctttatggcagtaaaatgtctaggactgtgtgtgtt
cggctcatctctgtgccttatgtctatggattctctgtcagcctaatatgcacactatgg
acttatggcttatacttctgtggaaactttgaaatcaatcacttctattgtgcagatccc
cctctcatccagattgcctgtgggagagtgcacatcaaagaaatcacaatgattgttatt
gctggaattaacttcacatattccctctcggtggtcctcatctcctacactctcattgta
gtagctgtgctacgcatgcgctctgccgatggcaggaggaaggcgttctccacctgtggg
tcccacttgacggctgtttctatgttttatgggacccccatcttcatgtatctcaggaga
cccactgaggaatccgtagagcagggcaaaatggtggctgtgttttacaccacagtaatt
cctatgttgaatcccatgatctacagtctgagaaataaggatgtaaaagaagcagtcaac
aaagcaatcaccaagacatatgtgaggcagtaa

DBGET integrated database retrieval system