KEGG   Homo sapiens (human): 390162Help
Entry
390162            CDS       T01001                                 

Gene name
OR5M9, OR11-190
Definition
olfactory receptor, family 5, subfamily M, member 9
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390162 (OR5M9)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390162 (OR5M9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 310 aa AA seqDB search
MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISISPQLQSPMYFF
LSHLSFADVCFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIAVVHVEVYILAVMAFDR
YMAGCNPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADP
PLIQIACGRVHIKEITMIVIAGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCG
SHLTAVSMFYGTPIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVN
KAITKTYVRQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatttcacggatgtgacagaatttactctcctggggctgacctgtcgtcaggag
ctacaggttctcttttttgtggtgttcctagcggtttacatgatcactctgttgggaaat
attggtatgatcattttgattagcatcagtcctcagcttcagagtcccatgtactttttc
ctgagtcatctgtcttttgcggacgtgtgcttctcctccaacgttacccccaaaatgctg
gaaaacttattatcagagacaaaaaccatttcctatgtgggatgcttggtgcagtgctac
tttttcattgccgttgtccacgtggaggtctatatcctggctgtgatggcctttgacagg
tacatggccggctgcaaccctctgctttatggcagtaaaatgtctaggactgtgtgtgtt
cggctcatctctgtgccttatgtctatggattctctgtcagcctaatatgcacactatgg
acttatggcttatacttctgtggaaactttgaaatcaatcacttctattgtgcagatccc
cctctcatccagattgcctgtgggagagtgcacatcaaagaaatcacaatgattgttatt
gctggaattaacttcacatattccctctcggtggtcctcatctcctacactctcattgta
gtagctgtgctacgcatgcgctctgccgatggcaggaggaaggcgttctccacctgtggg
tcccacttgacggctgtttctatgttttatgggacccccatcttcatgtatctcaggaga
cccactgaggaatccgtagagcagggcaaaatggtggctgtgttttacaccacagtaatt
cctatgttgaatcccatgatctacagtctgagaaataaggatgtaaaagaagcagtcaac
aaagcaatcaccaagacatatgtgaggcagtaa

DBGET integrated database retrieval system