KEGG   Homo sapiens (human): 390167Help
Entry
390167            CDS       T01001                                 

Gene name
OR5M10, OR11-207
Definition
(RefSeq) olfactory receptor family 5 subfamily M member 10
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390167 (OR5M10)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390167 (OR5M10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390167
NCBI-ProteinID: NP_001004741
HGNC: 15290
Ensembl: ENSG00000254834
Vega: OTTHUMG00000166862
Pharos: Q6IEU7(Tdark)
UniProt: Q6IEU7
Position
11q12.1
AA seq 315 aa AA seqDB search
MLSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSQLQTPMY
FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYFLASMAL
DRYVAICSPLHYSSRMSKNICISLVTVPYMYGFLNGLSQTLLTFHLSFCGSLEINHFYCA
DPPLIMLACSDTRVKKMAMFVVAGFTLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST
CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYTFLSPMLNPLIYSLRNRDVILA
IQQMIRGKSFCKIAV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccccaaaccacaccatagtgacagaattcattctcttaggactgacagacgac
ccagtgctagagaagatcctgtttggggtgttcctggcgatctacctaatcacactggca
ggcaacctgtgcatgatcctgctgatcaggaccaattcccaactgcaaacacccatgtat
ttcttccttggtcacctctcctttgtagacatttgctattcttccaatgttactccaaat
atgctgcacaatttcctctcagaacagaagaccatctcctacgctggatgcttcacacag
tgtcttctcttcatcgccctagtgatcactgagttttacttccttgcttcaatggcattg
gatcgctatgtagccatttgcagccctttacattacagttccaggatgtccaagaacatt
tgcatctctctggtcactgtgccttacatgtatggcttccttaatgggctctctcagaca
ctgctgacctttcacttatccttctgtggctcccttgaaatcaatcatttctactgcgct
gatcctcctcttatcatgctggcctgctctgacacccgtgtcaaaaagatggcaatgttt
gtagttgcaggctttactctctcaagctctctcttcatcattcttctgtcctatcttttc
atttttgcagcgatcttcaggatccgttctgctgaaggcaggcacaaagccttttctacg
tgtgcttcccacctgacaatagtcactttgttttatggaaccctcttctgcatgtacgta
aggcctccatcagagaagtctgtagaggagtccaaaataattgcagtcttttatactttt
ttgagcccaatgctgaacccattgatctatagcctacggaacagagatgtaatccttgcc
atacaacaaatgattaggggaaaatccttttgtaaaattgcagtttag

DBGET integrated database retrieval system