KEGG   Homo sapiens (human): 390181Help
Entry
390181            CDS       T01001                                 

Gene name
OR5AK2
Definition
(RefSeq) olfactory receptor family 5 subfamily AK member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390181 (OR5AK2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390181 (OR5AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390181
NCBI-ProteinID: NP_001005323
HGNC: 15251
Ensembl: ENSG00000181273
Vega: OTTHUMG00000167019
Pharos: Q8NH90(Tdark)
UniProt: Q8NH90 A0A126GW20
Position
11q12.1
AA seq 309 aa AA seqDB search
MTLGNSTEVTEFYLLGFGAQHEFWCILFIVFLLIYVTSIMGNSGIILLINTDSRFQTLTY
FFLQHLAFVDICYTSAITPKMLQSFTEEKNLMLFQGCVIQFLVYATFATSDCYLLAMMAV
DPYVAICKPLHYTVIMSRTVCIRLVAGSYIMGSINASVQTGFTCSLSFCKSNSINHFFCD
VPPILALSCSNVDINIMLLVVFVGSNLIFTGLVVIFSYIYIMATILKMSSSAGRKKSFST
CASHLTAVTIFYGTLSYMYLQSHSNNSQENMKVAFIFYGTVIPMLNPLIYSLRNKEVKEA
LKVIGKKLF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacactaggaaacagcactgaagtcactgaattctatcttctgggatttggtgcccag
catgagttttggtgtatcctcttcattgtattccttctcatctatgtgacctccataatg
ggtaatagtggaataatcttactcatcaacacagattccagatttcaaacactcacgtac
ttttttctacaacatttggcttttgttgatatctgttacacttctgctatcactcccaag
atgctccaaagcttcacagaagaaaagaatttgatgttatttcagggctgtgtgatacaa
ttcttagtttatgcaacatttgcaaccagtgactgttatctcctggctatgatggcagtg
gatccttatgttgccatctgtaagccccttcactatactgtaatcatgtcccgaacagtc
tgcatccgtttggtagctggttcatacatcatgggctcaataaatgcctctgtacaaaca
ggttttacatgttcactgtccttctgcaagtccaatagcatcaatcactttttctgtgat
gttccccctattcttgctctttcatgctccaatgttgacatcaacatcatgctacttgtt
gtctttgtgggatctaacttgatattcactgggttggtcgtcatcttttcctacatctac
atcatggccaccatcctgaaaatgtcttctagtgcaggaaggaaaaaatccttctcaaca
tgtgcttcccacctgaccgcagtcaccattttctatgggacactctcttacatgtatttg
cagtctcattctaataattcccaggaaaatatgaaagtggcctttatattttatggcaca
gttattcccatgttaaatcctttaatctatagcttgagaaataaggaagtaaaagaagct
ttaaaagtgatagggaaaaagttattttaa

DBGET integrated database retrieval system