KEGG   Homo sapiens (human): 390195Help
Entry
390195            CDS       T01001                                 

Gene name
OR5AN1, OR11-244
Definition
(RefSeq) olfactory receptor family 5 subfamily AN member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390195 (OR5AN1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390195 (OR5AN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390195
NCBI-ProteinID: NP_001004729
OMIM: 615702
HGNC: 15255
Ensembl: ENSG00000176495
Vega: OTTHUMG00000167337
Pharos: Q8NGI8(Tdark)
UniProt: Q8NGI8 A0A126GVP9
Position
11q12.1
AA seq 311 aa AA seqDB search
MTGGGNITEITYFILLGFSDFPRIIKVLFTIFLVIYITSLAWNLSLIVLIRMDSHLHTPM
YFFLSNLSFIDVCYISSTVPKMLSNLLQEQQTITFVGCIIQYFIFSTMGLSESCLMTAMA
YDRYAAICNPLLYSSIMSPTLCVWMVLGAYMTGLTASLFQIGALLQLHFCGSNVIRHFFC
DMPQLLILSCTDTFFVQVMTAILTMFFGIASALVIMISYGYIGISIMKITSAKGRSKAFN
TCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
ALKRLQKRKCC
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgggggaggaaatattacagaaatcacctatttcatcctgctgggattctcagat
tttcccaggatcataaaagtgctcttcactatattcctggtgatctacattacatctctg
gcctggaacctctccctcattgttttaataaggatggattcccacctccatacacccatg
tatttcttcctcagtaacctgtccttcatagatgtctgctatatcagctccacagtcccc
aagatgctctccaacctcttacaggaacagcaaactatcacttttgttggttgtattatt
cagtactttatcttttcaacgatgggactgagtgagtcttgtctcatgacagccatggct
tatgatcgttatgctgccatttgtaaccccctgctctattcatccatcatgtcacccacc
ctctgtgtttggatggtactgggagcctacatgactggcctcactgcttctttattccaa
attggtgctttgcttcaactccacttctgtgggtctaatgtcatcagacatttcttctgt
gacatgccccaactgttaatcttgtcctgtactgacactttctttgtacaggtcatgact
gctatattaaccatgttctttgggatagcaagtgccctagttatcatgatatcctatggc
tatattggcatctccatcatgaagatcacttcagctaaaggcaggtccaaggcattcaac
acctgtgcttctcatctaacagctgtttccctcttctatacatcaggaatctttgtctat
ttgagttccagctctggaggttcttcaagctttgacagatttgcatctgttttctacact
gtggtcattcccatgttaaatcccttgatttacagtttgaggaacaaagaaattaaagat
gccttaaagaggttgcaaaagagaaagtgctgctga

DBGET integrated database retrieval system