KEGG   Homo sapiens (human): 390201Help
Entry
390201            CDS       T01001                                 

Gene name
OR10V1, OR11-256
Definition
(RefSeq) olfactory receptor family 10 subfamily V member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390201 (OR10V1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390201 (OR10V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390201
NCBI-ProteinID: NP_001005324
HGNC: 15136
Ensembl: ENSG00000172289
Vega: OTTHUMG00000167406
Pharos: Q8NGI7(Tdark)
UniProt: Q8NGI7
Position
11q12.1
AA seq 309 aa AA seqDB search
MEGINKTAKMQFFFRPFSPDPEVQMLIFVVFLMMYLTSLGGNATIAVIVQINHSLHTPMY
FFLANLAVLEIFYTSSITPLALANLLSMGKTPVSITGCGTQMFFFVFLGGADCVLLVVMA
YDQFIAICHPLRYRLIMSWSLCVELLVGSLVLGFLLSLPLTILIFHLPFCHNDEIYHFYC
DMPAVMRLACADTRVHKTALYIISFIVLSIPLSLISISYVFIVVAILRIRSAEGRQQAYS
TCSSHILVVLLQYGCTSFIYLSPSSSYSPEMGRVVSVAYTFITPILNPLIYSLRNKELKD
ALRKALRKF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaataaataaaactgcaaagatgcagtttttctttcgtccattctcacctgac
cctgaggtccagatgctgatttttgtggtcttcctgatgatgtatctgaccagcctcggt
ggaaatgctacaattgcagtcattgttcagatcaatcattccctccacacccccatgtac
tttttcctggctaatctggcagttctagaaatcttctatacatcttccatcaccccattg
gccttggcaaacctcctttcaatgggcaaaactcctgtttccatcacgggatgtggcacc
cagatgtttttctttgtcttcttgggtggggctgattgtgtcctgctggtagtcatggct
tatgaccagtttatagcgatctgtcaccctctgcgatacaggctcatcatgagctggtcc
ttgtgtgtggagctgctggtaggctccttggtgctggggttcctgttgtcactgccactc
accattttaatcttccatctcccattctgccacaatgatgagatctaccacttctactgt
gacatgcctgcagtcatgcgcctggcttgtgcagacacacgcgttcacaagactgctctg
tatatcatcagcttcatcgtccttagcatccccctctcattgatctccatctcctatgtc
ttcatcgtggtagccattttacggatccggtcagcagaagggcgccagcaagcctactct
acctgctcttctcacatcttagtggtcctcctgcagtatggctgcaccagctttatatac
ttgtcccccagttccagctactctcctgagatgggccgggtggtatctgtggcctacaca
tttatcactcccattttaaaccccttgatctatagtttgaggaacaaggaactgaaagat
gccctaaggaaagcattgagaaaattctag

DBGET integrated database retrieval system