KEGG   Homo sapiens (human): 390261Help
Entry
390261            CDS       T01001                                 

Gene name
OR6M1, OR11-271
Definition
(RefSeq) olfactory receptor family 6 subfamily M member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390261 (OR6M1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390261 (OR6M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390261
NCBI-ProteinID: NP_001005325
HGNC: 14711
Ensembl: ENSG00000196099
Vega: OTTHUMG00000166012
Pharos: Q8NGM8(Tdark)
UniProt: Q8NGM8 A0A126GVK2
Position
11q24.1
AA seq 313 aa AA seqDB search
MGNWSTVTEITLIAFPALLEIRISLFVVLVVTYTLTATGNITIISLIWIDHRLQTPMYFF
LSNLSFLDILYTTVITPKLLACLLGEEKTISFAGCMIQTYFYFFLGTVEFILLAVMSFDR
YMAICDPLHYTVIMNSRACLLLVLGCWVGAFLSVLFPTIVVTRLPYCRKEINHFFCDIAP
LLQVACINTHLIEKINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCAS
HITVVSIAHGSNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE
TVNRIMTLIQRKT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactggagcactgtgactgaaatcaccctaattgccttcccagctctcctggag
attcgaatatctctcttcgtggttcttgtggtaacttacacattaacagcaacaggaaac
atcaccatcatctccctgatatggattgatcatcgcctgcaaactccaatgtacttcttc
ctcagtaatttgtcctttctggatatcttatacaccactgtcattaccccaaagttgttg
gcctgcctcctaggagaagagaaaaccatatcttttgctggttgcatgatccaaacatat
ttctacttctttctggggacggtggagtttatcctcttggcggtgatgtcctttgaccgc
tacatggctatctgcgacccactgcactacacggtcatcatgaacagcagggcctgcctt
ctgctggttctgggatgctgggtgggagccttcctgtctgtgttgtttccaaccattgta
gtgacaaggctaccttactgtaggaaagaaattaatcatttcttctgtgacattgcccct
cttcttcaggtggcctgtataaatactcacctcattgagaagataaactttctcctctct
gcccttgtcatcctgagctccctggcattcactactgggtcctacgtgtacataatttct
accatcctgcgtatcccctccacccagggccgtcagaaagctttttctacctgtgcttct
cacatcactgttgtctccattgcccacgggagcaacatctttgtgtatgtgagacccaat
cagaactcctcactggattatgacaaggtggccgctgtcctcatcacagtggtgacccct
ctcctgaacccttttatctacagcttgaggaatgagaaggtacaggaagtgttgagagag
acagtgaacagaatcatgaccttgatacaaaggaaaacttga

DBGET integrated database retrieval system