KEGG   Homo sapiens (human): 390265Help
Entry
390265            CDS       T01001                                 

Gene name
OR10G7, OR11-283
Definition
(RefSeq) olfactory receptor family 10 subfamily G member 7
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390265 (OR10G7)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390265 (OR10G7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390265
NCBI-ProteinID: NP_001004463
HGNC: 14842
Ensembl: ENSG00000182634
Vega: OTTHUMG00000165969
Pharos: Q8NGN6(Tdark)
UniProt: Q8NGN6 A0A126GWF3
Position
11q24.2
AA seq 311 aa AA seqDB search
MSNATLLTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRTISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTNMMTGRSCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA
PPILKLACADTSANEMVIFVNIGLVASGCFVLIVLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRDALHGVVAVFYTTLTPLFNPVVYTLRNKEVKKALLK
LKNGSVFAQGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgccaccctactgacagcgttcatcctcacgggccttccccatgccccaggg
ctggacgcccccctctttggaatcttcctggtggtttacgtgctcactgtgctggggaac
ctcctcatcctgctggtgatcagggtggattctcacctccacacccccatgtactacttc
ctcaccaacctgtccttcattgacatgtggttctccactgtcacggtgcccaaaatgctg
atgaccttggtgtccccaagcggcaggactatctccttccacagctgcgtggctcagctc
tattttttccacttcctggggagcaccgagtgtttcctctacacagtcatgtcctatgat
cgctacctggccatcagttacccgctcaggtacaccaacatgatgactgggcgctcgtgt
gccctcctggccaccggcacttggctcagtggctctctgcactctgctgtccagaccata
ttgactttccatttgccctactgtggacccaaccagatccagcactacttctgtgacgca
ccgcccatcctgaaactggcctgtgcagacacctcagccaacgagatggtcatctttgtg
aatattgggctagtggcctcgggctgctttgtcctgatagtgctgtcctatgtgtccatc
gtctgttccatcctgcggatccgcacctcagaggggaggcacagagcctttcagacctgt
gcctcccactgtatcgtggtcctttgcttctttggccctggtcttttcatttacctgagg
ccaggctccagggacgccttgcatggggttgtggccgttttctacaccacgctgactcct
cttttcaaccctgttgtgtacaccctgagaaacaaggaggtaaagaaagctctgttgaag
ctgaaaaatgggtcagtatttgctcagggtgaatag

DBGET integrated database retrieval system