KEGG   Homo sapiens (human): 390323Help
Entry
390323            CDS       T01001                                 

Gene name
OR6C75
Definition
olfactory receptor, family 6, subfamily C, member 75
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390323 (OR6C75)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390323 (OR6C75)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MRNSTAVTDFILLGLTSDPQWQVVLFIFLLVTYMLSVTGNLIIITLTLSDPHLQTPMYFF
LRNFSFLEISFTSVCIPRFLVTVVTGNRTISYNGCVAQLFFFIFLGVTEFYLLAAMSYDR
CMAICKPLHYTIIMSTRVCTLLVFSSWLAGFLIIFPPVMLLLQLDFCASNVIDHFICDSS
PMLQLSCTNTHFLELMAFFLAVVTLMVTLTLVILSYTNIIRTILKIPSMSQRKKAFSTCS
SHMIVVSISYSSCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFK
SMVQKMIFSLNK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattccacagcagtaacagactttattcttcttggattgacaagtgacccacag
tggcaggttgtacttttcatatttcttcttgttacctacatgttaagtgtgactgggaac
ctgatcattatcaccctcaccctttcagatccccatctgcagactcccatgtatttcttc
cttcggaacttctcattcctggaaatttcattcacgtctgtctgcattcccagattcctt
gtcactgttgtgacaggaaacagaaccatttcttataatgggtgtgtggctcagctattt
tttttcatcttcttgggggtgacagaattttaccttctggctgccatgtcctatgaccgc
tgcatggccatctgcaaacctcttcattacacaatcatcatgagcaccagagtgtgtacc
cttcttgtctttagctcctggcttgcagggtttctgatcatctttccaccagtaatgctt
ctgctgcagttggatttctgtgcctccaatgtaattgatcattttatctgtgactcttct
ccaatgctgcagctctcttgcacaaacactcactttctagaactcatggcatttttttta
gctgtggtaacactgatggtcaccttgacattagttattctctcctacacaaacatcatc
cggacaattctgaaaattccttctatgagtcaaaggaaaaaagccttttccacttgctcc
tcccatatgatagttgtctccatctcttacagtagctgtatcttcatgtacattaagact
tctgccagagaaagggtgactttaagcaaaggagtagctgtgctcaatacctcagtggct
cctctcttgaatcccttcatatacacactgagaaataagcaagtgaagcaagccttcaag
agcatggtccagaagatgattttttctttaaataaatga

DBGET integrated database retrieval system