KEGG   Homo sapiens (human): 390326Help
Entry
390326            CDS       T01001                                 

Gene name
OR6C76
Definition
olfactory receptor, family 6, subfamily C, member 76
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390326 (OR6C76)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390326 (OR6C76)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFF
LRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCY
VAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAP
LLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSS
HVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKD
VLRKISHKKKKH
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagaacatcagtgacagatttcatccttctgggtctgacggataatccgcaa
ctgcaggttgtgattttctcgttcctatttcttacgtatgtactgagtgttactggaaat
ctaactatcatctcccttaccctgctggattcccacctgaagacccccatgtatttcttc
ctcaggaatttctccttggaaatttcatttacttctgtctgtaatcctagatttctgatc
agcattctaacaggggacaaatccatatcttataatgcttgtgcagctcagctatttttc
tttatcttccttggctcaacggagtttttcctcctggcctctatgtcctatgattgctat
gtggctatatgtaagcctctgcattatacaaccatcatgagtgacaggatctgttatcag
cttataatcagctcttggctggctggtttcttggtaatttttccaccactggccatgggc
ttacagctggatttctgtgactccaatgtcattgaccactttacctgtgactctgctcct
ttgctgcaaatctcttgcacagacacaagtactctagagctcatgagctttattttagct
ctgtttactcttatatccactttgatattagtaattctctcctatacttacatcatcaga
actattctgagaatcccctcagcacagcaaagaaaaaaagccttttcaacctgctcctca
catgtgattgttgtctctatctcttatggaagctgcatcttcatgtatgtgaaaacatca
gcaaaggaaggagttgctttgacaaaaggagtagctatactcaatacctctgtcgctcct
atgctgaatccatttatttacactctaagaaaccagcaggtgaaacaagcatttaaggat
gttctgagaaagatttcccacaaaaaaaaaaaacactga

DBGET integrated database retrieval system