KEGG   Homo sapiens (human): 390327Help
Entry
390327            CDS       T01001                                 

Gene name
OR6C70
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 70
  KO
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390327 (OR6C70)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390327 (OR6C70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MKNHTRQIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLKTPMYFF
LRNFSFLEISFTTACIPRFLITIVTREKTISCNGCISQLFFYIFLGVTEFFLLAALSYDR
YVAICKPLRYMSIMSNKVCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDIS
LILQLSCSDTHLLELIAFLLAVMTLIVTLFLVILSYSYIIKTILKFPSAQQKKKAFSTCS
SHMIVVSITYGSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK
AVFRKIFSASDK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcatacaaggcagatagaatttattcttctgggactgacggataattctcag
ttacagattgtaattttcttatttctacttctaaattgtgtgttgagcatgatagggaac
ttcactatcattgccctcattctgctggattcccagctcaagactccaatgtatttcttc
ctccgtaatttctcttttctggaaatttcattcacaactgcttgcattcccagattccta
atcaccattgttaccagggaaaagaccatttcctgtaatggttgcatatctcagttgttt
ttttacatattcttgggggttacagaatttttccttctagctgctctgtcctatgatcgc
tatgttgccatctgcaaacctttgcgttatatgtccatcatgagtaacaaagtttgctac
cagcttgtattcagttcttgggtaactggattcctgatcattttcactccactgatttta
ggtcttaacttggatttctgtgcttcaaatatcattgatcatttcatttgtgacatttct
cttatcctacaactttcttgctcagacacacatttactggaactgattgcctttttatta
gctgtgatgacacttattgtcacattgtttttagtaatcctttcttactcttacatcatc
aagacaattctgaaattcccttcagctcagcaaaagaagaaagccttttccacctgctct
tctcacatgattgttgtctccatcacttatggtagttgtatgtttatctacataaagcca
tcagcgaatgaaagagttgctttaagcaaaggagtaactgtgctcaatacttcagttgcc
ccgttgttaaacccatttatttatactctgaggaatcagcaagttaaacaagccttcaaa
gctgtatttagaaagatattttctgcttcagacaagtaa

DBGET integrated database retrieval system