KEGG   Homo sapiens (human): 390327Help
Entry
390327            CDS       T01001                                 

Gene name
OR6C70
Definition
olfactory receptor, family 6, subfamily C, member 70
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MKNHTRQIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLKTPMYFF
LRNFSFLEISFTTACIPRFLITIVTREKTISCNGCISQLFFYIFLGVTEFFLLAALSYDR
YVAICKPLRYMSIMSNKVCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDIS
LILQLSCSDTHLLELIAFLLAVMTLIVTLFLVILSYSYIIKTILKFPSAQQKKKAFSTCS
SHMIVVSITYGSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK
AVFRKIFSASDK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcatacaaggcagatagaatttattcttctgggactgacggataattctcag
ttacagattgtaattttcttatttctacttctaaattgtgtgttgagcatgatagggaac
ttcactatcattgccctcattctgctggattcccagctcaagactccaatgtatttcttc
ctccgtaatttctcttttctggaaatttcattcacaactgcttgcattcccagattccta
atcaccattgttaccagggaaaagaccatttcctgtaatggttgcatatctcagttgttt
ttttacatattcttgggggttacagaatttttccttctagctgctctgtcctatgatcgc
tatgttgccatctgcaaacctttgcgttatatgtccatcatgagtaacaaagtttgctac
cagcttgtattcagttcttgggtaactggattcctgatcattttcactccactgatttta
ggtcttaacttggatttctgtgcttcaaatatcattgatcatttcatttgtgacatttct
cttatcctacaactttcttgctcagacacacatttactggaactgattgcctttttatta
gctgtgatgacacttattgtcacattgtttttagtaatcctttcttactcttacatcatc
aagacaattctgaaattcccttcagctcagcaaaagaagaaagccttttccacctgctct
tctcacatgattgttgtctccatcacttatggtagttgtatgtttatctacataaagcca
tcagcgaatgaaagagttgctttaagcaaaggagtaactgtgctcaatacttcagttgcc
ccgttgttaaacccatttatttatactctgaggaatcagcaagttaaacaagccttcaaa
gctgtatttagaaagatattttctgcttcagacaagtaa

DBGET integrated database retrieval system