KEGG   Homo sapiens (human): 390429Help
Entry
390429            CDS       T01001                                 

Gene name
OR4N2, OR14-13, OR14-8
Definition
(RefSeq) olfactory receptor family 4 subfamily N member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390429 (OR4N2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390429 (OR4N2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 UL41A
Motif
Other DBs
NCBI-GeneID: 390429
NCBI-ProteinID: NP_001004723
HGNC: 14742
Ensembl: ENSG00000176294
Vega: OTTHUMG00000170614
Pharos: Q8NGD1(Tdark)
UniProt: Q8NGD1 A0A126GVT2
Position
14q11.2
AA seq 307 aa AA seqDB search
MESENRTVIREFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIKSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSAKKIISYRGCITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYPTVMNPRTCYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRIRGSSSEAKNKAMSTC
ITHIIVIFFMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKK
VFNKHIA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgagaacagaacagtgataagagaattcatcctccttggtctgacccagtct
caagatattcagctcctggtctttgtgctagttttaatattctacttcatcatcctccct
ggaaattttctcattattttcaccataaagtcagaccctgggctcacagcccccctctat
ttctttctgggcaacttggccttcctggatgcatcctactccttcattgtggctccccgg
atgttggtggacttcctctctgcgaagaagataatctcctacagaggctgcatcactcag
ctctttttcttgcacttccttggaggaggggagggattactccttgttgtgatggccttt
gaccgctacatcgccatctgccggcctctgcactatcctactgtcatgaaccctagaacc
tgctatgcaatgatgttggctctgtggcttgggggttttgtccactccattatccaggtg
gtcctcatcctccgcttgcctttttgtggcccaaaccagctggacaacttcttctgtgat
gtcccacaggtcatcaagctggcctgcaccgacacatttgtggtggagcttctgatggtc
ttcaacagtggcctgatgacactcctgtgctttctggggcttctggcctcctatgcagtc
attctttgtcgcatacgagggtcttcttctgaggcaaaaaacaaggccatgtccacgtgc
atcacccatatcattgttatattcttcatgtttggacctggcatcttcatctacacgcgc
cccttcagggctttcccagctgacaaggtggtttctctcttccacacagtgatttttcct
ttgttgaatcctgtcatttatacccttcgcaaccaggaagtgaaagcttccatgaaaaag
gtgtttaataagcacatagcctga

DBGET integrated database retrieval system