KEGG   Homo sapiens (human): 390439Help
Entry
390439            CDS       T01001                                 

Gene name
OR11G2, OR14-34
Definition
olfactory receptor, family 11, subfamily G, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390439 (OR11G2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390439 (OR11G2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 345 aa AA seqDB search
MHFLSQNDLNINLIPHLCLHRHSVIAGAFTIHRHMKIFNSPSNSSTFTGFILLGFPCPRE
GQILLFVLFTVVYLLTLMGNGSIICAVHWDQRLHAPMYILLANFSFLEICYVTSTVPSML
ANFLSDTKIISFSGCFLQFYFFFSLGSTECFFLAVMAFDRYLAICRPLRYPTIMTRRLCT
NLVVNCWVLGFIWFLIPIVNISQMSFCGSRIIDHFLCDPAPLLTLTCKKGPVIELVFSVL
SPLPVFMLFLFIVGSYALVVRAVLRVPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSP
PSKNEAGKQKTVTLFYSVVTPLLNPVIYSLRNKDMRKALKKFWGT
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcattttctttcccaaaatgatttaaatataaatctgattccccatctatgtttgcac
cgtcattcagtaattgctggtgcttttacaattcacaggcacatgaaaatcttcaacagc
cccagcaactccagcaccttcactggcttcatcctcctgggcttcccttgccccagggag
gggcagatcctcctctttgtgctcttcactgttgtttacctcctgaccctcatgggcaat
ggttccatcatctgtgctgtgcactgggatcagagactccacgcccccatgtacatcctg
ctcgccaacttctccttcttggagatatgttatgtcacctccacagtccccagcatgctg
gccaacttcctctctgacaccaagatcatctcgttctctggctgcttcctccagttctac
tttttcttctccttgggctctacagaatgctttttcctggcagttatggcatttgatcga
taccttgccatctgtcggcctctacgctatccaaccattatgaccagacgtctctgtacc
aatcttgtggtcaattgctgggtacttggtttcatctggttcttgattcctatcgtcaac
atctcccaaatgtccttctgtggatctaggattattgaccacttcctatgtgacccagct
cctcttctaactctcacttgcaaaaaaggccctgtgatagagcttgtcttttctgtctta
agtcctctgcctgtctttatgctctttctcttcattgtggggtcctatgctctggtcgtg
agagctgtgttgagggtcccttcagcagctgggagaagaaaggctttctccacctgtggg
tctcacctggctgtggtttcactgttctacggctcagtactggtcatgtatgggagccca
ccatctaagaatgaagctggaaagcagaagactgtgactctgttttattctgttgttacc
ccactgcttaaccctgtgatatatagtcttaggaacaaagatatgagaaaagctctgaag
aaattttggggaacataa

DBGET integrated database retrieval system