KEGG   Homo sapiens (human): 390538Help
Entry
390538            CDS       T01001                                 

Gene name
OR4M2, OR15-3
Definition
(RefSeq) olfactory receptor family 4 subfamily M member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390538 (OR4M2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390538 (OR4M2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390538
NCBI-ProteinID: NP_001004719
HGNC: 15373
Ensembl: ENSG00000274102
Vega: OTTHUMG00000171738
Pharos: Q8NGB6(Tdark)
UniProt: Q8NGB6
Position
15q11.2
AA seq 313 aa AA seqDB search
METANYTKVTEFVLTGLSQTPEVQLVLFVIFLSFYLFILPGNILIICTISLDPHLTSPMY
FLLANLAFLDIWYSSITAPEMLIDFFVERKIISFDGCIAQLFFLHFAGASEMFLLTVMAF
DLYTAICRPLHYATIMNQRLCCILVALSWRGGFIHSIIQVALIVRLPFCGPNELDSYFCD
ITQVVRIACANTFPEELVMICSSGLISVVCLIALLMSYAFLLALFKKLSGSGENTNRAMS
TCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFNTLIFPLRNPIIYTLRNKEVKAAM
RKLVTKYILCKEK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgcaaattacaccaaggtgacagaatttgttctcactggcctatcccagact
ccagaggtccaactagtcctatttgttatatttctatccttctatttgttcatcctacca
ggaaatatccttatcatttgcaccatcagtctagaccctcatctgacctctcctatgtat
ttcctgttggctaatctggccttccttgatatttggtactcttccattacagcccctgaa
atgctcatagacttctttgtggagaggaagataatttcttttgatggatgcattgcacag
ctcttcttcttacactttgctggggcttcggagatgttcttgctcacagtgatggccttt
gacctctacactgctatctgccgacccctccactatgctaccatcatgaatcaacgtctc
tgctgtatcctggtggctctctcctggagggggggcttcattcattctatcatacaggtg
gctctcattgttcgacttcctttctgtgggcccaatgagttagacagttacttctgtgac
atcacacaggttgtccggattgcctgtgccaacaccttcccagaggagttagtgatgatc
tgtagtagtggtctgatctctgtggtgtgtttgattgctctgttaatgtcctatgccttc
cttctggccttgttcaagaaactttcaggctcaggtgagaataccaacagggccatgtcc
acctgctattcccacattaccattgtggtgctaatgtttgggccatccatctacatttat
gctcgcccatttgactcgttttccctagataaagtggtgtctgtgttcaatactttaata
ttccctttacgtaatcccattatttacacattgagaaacaaggaagtaaaggcagccatg
aggaagttggtcaccaaatatattttgtgtaaagagaagtga

DBGET integrated database retrieval system