KEGG   Homo sapiens (human): 390649Help
Entry
390649            CDS       T01001                                 

Gene name
OR4F15
Definition
olfactory receptor, family 4, subfamily F, member 15
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 312 aa AA seqDB search
MNGMNHSVVSEFVFMGLTNSREIQLLLFVFSLLFYFASMMGNLVIVFTVTMDAHLHSPMY
FLLANLSIIDMAFCSITAPKMICDIFKKHKAISFRGCITQIFFSHALGGTEMVLLIAMAF
DRYMAICKPLHYLTIMSPRMCLYFLATSSIIGLIHSLVQLVFVVDLPFCGPNIFDSFYCD
LPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIFILFTVWKHSSGGLAKALSTL
SAHVTVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMRR
LCSRLAHFTKIL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaatgaatcactctgtggtatcagaatttgtattcatgggactcaccaactca
cgggagattcagcttctactttttgttttctctttgttgttctactttgcgagcatgatg
ggaaaccttgtcattgtattcactgtaaccatggatgctcatctgcactcccccatgtat
ttcctcctggctaacctctcaatcattgatatggcattttgctcaattacagcccctaag
atgatttgtgatattttcaagaagcacaaggccatctcctttcggggatgtattactcag
atcttctttagccatgctcttgggggcactgagatggtgctgctcatagccatggccttt
gacagatacatggccatatgtaaacctctccactacctgaccatcatgagcccaagaatg
tgtctatactttttagccacttcctctatcattggccttatccactcattggtccaatta
gtttttgtggtagatttacctttttgtggtcctaatatctttgacagtttttactgtgat
ctccctcggctcctcagacttgcctgtaccaacacccaagaactggagttcatggtcact
gtcaatagtggactcatttctgtgggctcctttgtcttgctggtaatttcctacatcttc
attctgttcactgtttggaaacattcttctggtggtctagccaaggccctctctaccctg
tcagctcatgtcactgtggtcatcttgttctttgggccactgatgtttttctacacatgg
ccttctcccacatcacacctggataaatatcttgctatttttgatgcatttattactcct
tttctgaatccagttatctacacattcaggaacaaagacatgaaagtggcaatgaggaga
ctgtgcagtcgtcttgcgcattttacaaagattttgtaa

DBGET integrated database retrieval system