KEGG   Homo sapiens (human): 390649Help
Entry
390649            CDS       T01001                                 

Gene name
OR4F15
Definition
(RefSeq) olfactory receptor family 4 subfamily F member 15
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390649 (OR4F15)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390649 (OR4F15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390649
NCBI-ProteinID: NP_001001674
HGNC: 15078
Ensembl: ENSG00000182854
Vega: OTTHUMG00000172268
Pharos: Q8NGB8(Tdark)
UniProt: Q8NGB8 A0A126GW41
Position
15q26.3
AA seq 312 aa AA seqDB search
MNGMNHSVVSEFVFMGLTNSREIQLLLFVFSLLFYFASMMGNLVIVFTVTMDAHLHSPMY
FLLANLSIIDMAFCSITAPKMICDIFKKHKAISFRGCITQIFFSHALGGTEMVLLIAMAF
DRYMAICKPLHYLTIMSPRMCLYFLATSSIIGLIHSLVQLVFVVDLPFCGPNIFDSFYCD
LPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIFILFTVWKHSSGGLAKALSTL
SAHVTVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMRR
LCSRLAHFTKIL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaatgaatcactctgtggtatcagaatttgtattcatgggactcaccaactca
cgggagattcagcttctactttttgttttctctttgttgttctactttgcgagcatgatg
ggaaaccttgtcattgtattcactgtaaccatggatgctcatctgcactcccccatgtat
ttcctcctggctaacctctcaatcattgatatggcattttgctcaattacagcccctaag
atgatttgtgatattttcaagaagcacaaggccatctcctttcggggatgtattactcag
atcttctttagccatgctcttgggggcactgagatggtgctgctcatagccatggccttt
gacagatacatggccatatgtaaacctctccactacctgaccatcatgagcccaagaatg
tgtctatactttttagccacttcctctatcattggccttatccactcattggtccaatta
gtttttgtggtagatttacctttttgtggtcctaatatctttgacagtttttactgtgat
ctccctcggctcctcagacttgcctgtaccaacacccaagaactggagttcatggtcact
gtcaatagtggactcatttctgtgggctcctttgtcttgctggtaatttcctacatcttc
attctgttcactgtttggaaacattcttctggtggtctagccaaggccctctctaccctg
tcagctcatgtcactgtggtcatcttgttctttgggccactgatgtttttctacacatgg
ccttctcccacatcacacctggataaatatcttgctatttttgatgcatttattactcct
tttctgaatccagttatctacacattcaggaacaaagacatgaaagtggcaatgaggaga
ctgtgcagtcgtcttgcgcattttacaaagattttgtaa

DBGET integrated database retrieval system