KEGG   Homo sapiens (human): 390892Help
Entry
390892            CDS       T01001                                 

Gene name
OR7A10, BC85395_3, OR19-18
Definition
(RefSeq) olfactory receptor family 7 subfamily A member 10
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390892 (OR7A10)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390892 (OR7A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390892
NCBI-ProteinID: NP_001005190
HGNC: 8356
Ensembl: ENSG00000127515
Vega: OTTHUMG00000183412
Pharos: O76100(Tdark)
UniProt: O76100 A0A126GVC8
Position
19p13.12
AA seq 309 aa AA seqDB search
MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQMCFFLLFVGLDNFLLTVMAY
DRFVAICHPLHYMVIMNPQLCGLLVLASWIMSVLNSMLQSLMVLPLPFCTHMEIPHFFCE
INQVVHLACSDTFLNDIVMYFAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFST
CASHLSVVSLFYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGA
MKTFFRGKQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatggaacaatacaataattttagaatttcttctcctgggaatttcagaggaa
ccagaattgcaggccttcctctttgggctgttcctgtccatgtacctggtcactgtgctc
gggaacctgctcatcatcctggccacaatctcagactcccacctccacacccccatgtac
ttcttcctctccaacctgtccttcgtagacatctgttttgtctctaccactgtcccgaag
atgctggtgaacatccagacacacaacaaagtcatcacctatgcaggctgcatcacccag
atgtgctttttcttactctttgtaggattggataacttccttctgaccgtgatggcctat
gaccggtttgtggccatctgtcaccctctgcactacatggtcattatgaaccctcaactc
tgtggactgctggttctggcatcctggatcatgagtgttctgaattccatgttacaaagc
ttaatggtgttgccactgcccttttgtacacacatggaaatccctcattttttctgtgaa
attaatcaggtggtccaccttgcctgttctgacacctttcttaatgacatagtgatgtat
tttgcagtagcgctgctgggcggtggtcccctcactgggatcctgtactcttactctaag
atagtttcctccatacgtgcaatctcatcagctcaggggaagtataaggcattttccacc
tgtgcatctcacctctcagttgtctccttattttatggtacatgcttaggggtgtacctt
agttctgctgccacccacaattcacacacaggtgctgcagcctcagtgatgtacactgtg
gtcacccccatgctgaaccccttcatctacagtctgaggaataaacacataaagggtgct
atgaaaacattcttcagaggaaagcaatag

DBGET integrated database retrieval system