KEGG   Homo sapiens (human): 390916Help
Entry
390916            CDS       T01001                                 

Gene name
NUDT19, RP2
Definition
nudix (nucleoside diphosphate linked moiety X)-type motif 19
Orthology
K13355  
nucleoside diphosphate-linked moiety X motif 19, mitochondrial [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    390916 (NUDT19)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     390916 (NUDT19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.11
AA seq 375 aa AA seqDB search
MSSSLRPGPSRWRRAASIVLAAGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAH
VFSGGVLDAADRSADWLGLFAPHHGPPRFGLGPAPFSRTAFPSLPDTDDHKTDNTGTLPE
DVAFRICAVREAFEEAGVLLLRPRTSPPGPAPGPGLALEPPPGLASWRDRVRQDPRHFLR
LCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVVGYQWS
SPSEATESFLSKEIWLPPPQFYEVRRLANFASLSDLHKFCLGRALEGLERWLPIILLTAD
GMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEGKQFHRIVTYHRHLYDIHVTVQPKY
KHVYPKNSVVRKSHL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctccctgcggccgggccccagccgctggcggcgggcggccagcatcgtcctg
gcggctggctggtcgcgcccggagaccgccaccccgccgtcgcgcccgccgccggccgag
ggcttccggctgctgctgctgcagcgctccccgcaccaaggcttcatgccgggcgcgcac
gtcttctccggcggagtgctggatgcggccgaccgctcggcggactggctgggcctcttc
gcgccgcaccacgggccgccgcgcttcggcctgggcccggcgccattcagccgcaccgct
ttcccgtcgctgcccgacaccgatgaccacaagaccgacaacactgggacgctgcctgag
gacgtagccttccgcatctgcgccgtgcgggaggcctttgaggaggcgggcgtgctgctg
ctgcggcccaggacttccccaccaggcccagcacccgggcctggcctcgccctggagcca
ccgccgggcctggcctcctggcgcgaccgcgtgcgccaggacccgcgccacttcctgcgg
ctgtgcgcccacctcgactgcacacccgacatctgggcgctgcacaactggagcgcctgg
ctcacccctttcttgcggggcaccactcgccgctttgacacggccttcttcctgtgctgc
ctgcgcgagccgccgcccgtctaccccgacttggcggaggtggtgggctaccagtggtca
tctccatcagaggcaactgaaagtttcttatcaaaagaaatttggttgccacccccacag
ttctacgaagtgagaagacttgcaaactttgcctctctctctgacttgcacaaattttgt
ttgggtcgtgcattagaaggactggaaaggtggctgccgatcatcttgttaactgctgat
gggatggtccatcttttaccaggtgatgagctatatttagaagattcagactttttggaa
aatcttatgtctactgaaaaaaagactgaggaaatcatgaaggaaggcaagcagtttcac
cggatagtgacataccatcgccacctttatgatatccacgtgactgttcagccaaagtat
aaacacgtttatcctaagaactctgtagtaagaaaaagccatttgtag

DBGET integrated database retrieval system