KEGG   Homo sapiens (human): 391013Help
Entry
391013            CDS       T01001                                 

Gene name
PLA2G2C
Definition
phospholipase A2, group IIC (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    391013 (PLA2G2C)
   00565 Ether lipid metabolism
    391013 (PLA2G2C)
   00590 Arachidonic acid metabolism
    391013 (PLA2G2C)
   00591 Linoleic acid metabolism
    391013 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    391013 (PLA2G2C)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    391013 (PLA2G2C)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    391013 (PLA2G2C)
  Digestive system
   04972 Pancreatic secretion
    391013 (PLA2G2C)
   04975 Fat digestion and absorption
    391013 (PLA2G2C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     391013 (PLA2G2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
UniProt: 
Position
1p36.12
AA seq 150 aa AA seqDB search
MLIATSFFLFFSSVVAAPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDD
TDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSV
HCFKESLPTYEKNFKQFSSQPRCGRHKPWC
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgctcattgcaacttccttcttcctttttttctcatcggtggtggcagcccccacccac
agcagtttctggcagtttcagaggagggtcaaacacatcacggggcgaagtgccttcttc
tcatattacggatatggctgctactgtgggcttggggataaagggatccccgtggatgac
actgacagcccctcatctccctctccctacgagaagctgaaggagttcagctgccagcct
gtgttgaacagctaccagttccacatcgtcaatggcgcagtggtttgtggatgcaccctt
ggtcctggtgccagctgccactgcaggctgaaggcctgtgagtgtgacaagcaatccgtg
cactgcttcaaagagagcctgcccacctatgagaaaaacttcaagcagttctccagccag
cccaggtgtggcagacataagccctggtgctag

DBGET integrated database retrieval system