KEGG   Homo sapiens (human): 391107Help
Entry
391107            CDS       T01001                                 

Gene name
OR10K2, OR1-4
Definition
olfactory receptor, family 10, subfamily K, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.1
AA seq 312 aa AA seqDB search
MERVNETVVREVIFLGFSSLARLQQLLFVIFLLLYLFTLGTNAIIISTIVLDRALHIPMY
FFLAILSCSEICYTFIIVPKMLVDLLSQKKTISFLGCAIQMFSFLFLGCSHSFLLAVMGY
DRYIAICNPLRYSVLMGHGVCMGLVAAACACGFTVAQIITSLVFHLPFYSSNQLHHFFCD
IAPVLKLASHHNHFSQIVIFMLCTLVLAIPLLLILVSYVHILSAILQFPSTLGRCKAFST
CVSHLIIVTVHYGCASFIYLRPQSNYSSSQDALISVSYTIITPLFNPMIYSLRNKEFKSA
LCKIVRRTISLL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggtcaatgagactgtggtgagagaggtcatcttcctcggcttctcatccctg
gccaggctgcagcagctgctctttgttatcttcctgctcctctacctgttcactctgggc
accaatgcaatcatcatttccaccattgtcctggacagggcccttcatatccccatgtac
ttcttccttgccatcctctcttgctctgagatttgctacaccttcatcattgtacccaag
atgctggttgacctgctgtcccagaagaagaccatttctttcctgggctgtgccatccaa
atgttttccttcctcttccttggctgctctcactcctttctgctggcagtcatgggttat
gatcgttacatagccatctgtaacccactgcgctactcagtgctaatgggacatggggtg
tgtatgggactagtggctgctgcctgtgcctgtggcttcactgttgcacagatcatcaca
tccttggtatttcacctgcctttttattcctccaatcaactacatcacttcttctgtgac
attgctcctgtcctcaagctggcatctcaccataaccactttagtcagattgtcatcttc
atgctctgtacattggtcctggctatccccttattgttgatcttggtgtcctatgttcac
atcctctctgccatacttcagtttccttccacactgggtaggtgcaaagctttttctacc
tgtgtatctcacctcattattgtcactgtccactatggctgtgcctcctttatctactta
aggcctcagtccaactactcctcaagccaggatgctctaatatcagtatcctacactatt
ataactccattgttcaacccaatgatttatagcttgagaaataaagagttcaaatcagct
ctttgtaaaattgtgagaagaacaatttccctgttgtaa

DBGET integrated database retrieval system