KEGG   Homo sapiens (human): 391109Help
Entry
391109            CDS       T01001                                 

Gene name
OR10K1, OR1-6
Definition
(RefSeq) olfactory receptor family 10 subfamily K member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    391109 (OR10K1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    391109 (OR10K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 391109
NCBI-ProteinID: NP_001004473
HGNC: 14693
Ensembl: ENSG00000173285
Vega: OTTHUMG00000017517
Pharos: Q8NGX5(Tdark)
UniProt: Q8NGX5 A0A126GV64
Position
1q23.1
AA seq 313 aa AA seqDB search
MEQVNKTVVREFVVLGFSSLARLQQLLFVIFLLLYLFTLGTNAIIISTIVLDRALHTPMY
FFLAILSCSEICYTFVIVPKMLVDLLSQKKTISFLGCAIQMFSFLFFGSSHSFLLAAMGY
DRYMAICNPLRYSVLMGHGVCMGLMAAACACGFTVSLVTTSLVFHLPFHSSNQLHHFFCD
ISPVLKLASQHSGFSQLVIFMLGVFALVIPLLLILVSYIRIISAILKIPSSVGRYKTFST
CASHLIVVTVHYSCASFIYLRPKTNYTSSQDTLISVSYTILTPLFNPMIYSLRNKEFKSA
LRRTIGQTFYPLS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagtcaataagactgtggtgagagagttcgtcgtcctcggcttctcatccctg
gccaggctgcagcagctgctctttgttatcttcctgctcctctacctgttcactctgggc
accaatgcaatcatcatttccaccattgtgctggacagagcccttcatactcccatgtac
ttcttccttgccatcctttcttgctctgagatttgctatacctttgtcattgtacccaag
atgctggttgacctgctgtcccagaagaagaccatttctttcctgggctgtgccatccaa
atgttttccttcctcttctttggctcctctcactccttcctgctggcagccatgggctat
gatcgctatatggccatctgtaacccactgcgctactcagtgctcatgggacatggggtg
tgtatgggactaatggctgctgcctgtgcctgtggcttcactgtctccctggtcaccacc
tccctagtatttcatctgcccttccactcctccaaccagctccatcacttcttctgtgac
atctcccctgtccttaaactggcatctcagcactccggcttcagtcagctggtcatattc
atgcttggtgtatttgccttggtcattcctctgctacttatcctagtctcctacatccgc
atcatctctgccattctaaaaatcccttcctccgttggaagatacaagaccttctccacc
tgtgcctcccatctcattgtggtaactgttcactacagttgtgcctctttcatctactta
aggcccaagactaattacacttcaagccaagacaccctaatatctgtgtcatacaccatc
cttaccccattgttcaatccaatgatttatagtctgagaaataaggaattcaaatcagcc
ctacgaagaacaatcggccaaactttctatcctcttagttaa

DBGET integrated database retrieval system