KEGG   Homo sapiens (human): 391114Help
Entry
391114            CDS       T01001                                 

Gene name
OR6K3, OR1-18
Definition
(RefSeq) olfactory receptor family 6 subfamily K member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    391114 (OR6K3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    391114 (OR6K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 391114
NCBI-ProteinID: NP_001005327
HGNC: 15030
Ensembl: ENSG00000203757
Vega: OTTHUMG00000022770
Pharos: Q8NGY3(Tdark)
UniProt: Q8NGY3 A0A0C4DFU5
Position
1q23.1
AA seq 315 aa AA seqDB search
MESGNQSTVTEFIFTGFPQLQDGSLLYFFPLLFIYTFIIIDNLLIFSAVRLDTHLHNPMY
NFISIFSFLEIWYTTATIPKMLSNLISEKKAISMTGCILQMYFFHSLENSEGILLTTMAI
DRYVAICNPLRYQMIMTPRLCAQLSAGSCLFGFLILLPEIVMISTLPFCGPNQIHQIFCD
LVPVLSLACTDTSMILIEDVIHAVTIIITFLIIALSYVRIVTVILRIPSSEGRQKAFSTC
AGHLMVFPIFFGSVSLMYLRFSDTYPPVLDTAIALMFTVLAPFFNPIIYSLRNKDMNNAI
KKLFCLQKVLNKPGG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggagagcggaaaccaatcaacagtgactgaatttatcttcactggattccctcagctt
caggatggtagtctcctgtacttctttcctttacttttcatctatacttttattatcatt
gataacttattaatcttctctgctgtaaggctggacacccatctccacaaccccatgtat
aattttatcagtatattttcctttctggagatctggtacaccacagccaccattcccaag
atgctctccaacctcatcagtgaaaagaaggccatctcaatgactggctgcatcttgcag
atgtatttcttccactcacttgaaaactcagaggggatcttgctgaccaccatggccatt
gacagatacgttgccatctgcaaccctcttcgctatcaaatgatcatgaccccccggctc
tgtgctcaactctctgcaggttcctgcctcttcggtttccttatcctgcttcccgagatt
gtgatgatttccacactgcctttctgtgggcccaaccaaatccatcagatcttctgtgac
ttggtccctgtgctaagcctggcctgtacagacacgtccatgattctgattgaggatgtg
attcatgctgtgaccatcatcattaccttcctaatcattgccctgtcctatgtaagaatt
gtcactgtgatattgaggattccctcttctgaagggaggcaaaaggctttttctacctgt
gcaggccacctcatggtcttcccgatattctttggcagtgtatcactcatgtacttgcgt
ttcagcgacacttatccaccagttttggacacagccattgcactgatgtttactgtactt
gctccattcttcaatcccatcatttatagcctgagaaacaaggacatgaacaatgcgatt
aaaaaactgttctgtcttcaaaaagtgttgaacaagcctggaggttaa

DBGET integrated database retrieval system