KEGG   Homo sapiens (human): 391194Help
Entry
391194            CDS       T01001                                 

Gene name
OR2M2, OR2M2Q, OST423
Definition
olfactory receptor, family 2, subfamily M, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    391194 (OR2M2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    391194 (OR2M2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 347 aa AA seqDB search
MAWENQTFNSDFILLGIFNHSPPHTFLFFLVLGIFLVAFMGNSVMVLLIYLDTQLHTPMY
FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCVTQIFFYISLSGSECFLLAVMAY
DRYIAICHPLRYTNLMNPKICGLMATFSWILGSTDGIIDAVATFSFSFCGSREIAHFFCE
FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIIASYARVILAVIHMGSGEGRCKAFTT
CSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA
FMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIMYIA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggagaatcagaccttcaactccgacttcatcctccttggaatcttcaatcac
agcccaccacacacgttcctcttctttctggtcctgggcatctttttagtggccttcatg
ggaaactctgtcatggttctcctcatctacctggacacccagctccacacccccatgtac
ttcctcctcagccaactgtccctcatggacctcatgctcatctgcaccaccgtacccaag
atggccttcaactacctgtctggcagcaagtccatttctatggctggttgtgtcacacaa
attttcttctatatatcactgtctggctctgaatgttttcttttggctgttatggcttat
gaccgctatattgctatttgccaccctctaagatataccaatctcatgaatcctaaaatt
tgtggacttatggctaccttctcctggatcctgggctctacagatggaatcattgatgct
gtagccacattttccttctccttttgtgggtctcgggaaatagcccacttcttctgtgaa
ttcccttccctactaatcctctcatgcaatgacacatcaatatttgaagaggttattttc
atctgctgtatagtaatgcttgttttccctgttgcaatcatcattgcttcctatgctcga
gttattctggctgtcattcacatgggatctggagagggtcgttgcaaagctttcacgacc
tgttcctctcacctcatggtggtgggaatgtactatggagcagctttgttcatgtacata
cggcccacatctgatcactccccaacgcaggacaagatggtgtctgtattctacaccatc
ctcactcccatgctgaatcccctcatctacagcctccgcaacaaggaggtgactagagca
ttcatgaagatcttaggaaagggcaagtctgagagtgagttacctcataaactttatgtt
ttgctgtttgctaaattcttctttctaatatccatctttttctatgatgtcaaaatacta
gcattgattatgtacattgcctaa

DBGET integrated database retrieval system