KEGG   Homo sapiens (human): 391195Help
Entry
391195            CDS       T01001                                 

Gene name
OR2T33, OR1-56
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 33
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    391195 (OR2T33)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    391195 (OR2T33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 391195
NCBI-ProteinID: NP_001004695
HGNC: 31255
Ensembl: ENSG00000177212
Vega: OTTHUMG00000040458
Pharos: Q8NG76(Tdark)
UniProt: Q8NG76
Position
1q44
AA seq 320 aa AA seqDB search
MEMRNTTPDFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL
LSQLSLMDMMLVSTTVPKMAADYLTGSKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR
YAAVCHPLRYPTLMSWQLCLRMTMSCWLLGAADGLLQAVVTLSFPYCGAHEIDHFFCETP
VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS
SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALK
RWLGTCVNIKHQQNEAHRSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagaaatactaccccagattttattctcctaggactctttaaccacaccaga
gcccaccaagtcctcttcatgatggttctgagtatcgttttgacctccctgtttggcaat
tccctcatgattctcctgattcactgggaccaccggctccacacgcccatgtacttcctc
ctgagccaactttccctcatggacatgatgctggtttccaccactgtgcccaaaatggcg
gctgactacttgaccggaagtaaggccatctcccgcgctggctgtggtgtgcagatcttc
ttcctccccacactgggtggtggagagtgcttcctcttagcagccatggcctatgaccgc
tatgcggctgtctgccacccactccgatatcccactctcatgagctggcagctgtgcctg
aggatgaccatgtcgtgttggctcctgggtgcagctgacgggctcctgcaggctgttgtt
accctgagcttcccatattgtggtgcacacgagatcgatcacttcttctgcgagaccccc
gtgctggtgcgtttggcttgtgctgacacttcagtcttcgaaaacgccatgtacatctgc
tgtgtgttaatgctcctggtccccttttccctcatcctgtcctcctatggtctcatcctc
gctgctgttctgcacatgcgctctacagaagcccgcaagaaggcctttgccacctgctct
tcacatgtggctgtggtgggactcttttatggagctgccatttttacctatatgagaccc
aaatcccataggtccactaaccatgacaaggttgtgtcagccttctatactatgttcacc
cctttactaaaccccctcatctacagtgtgaagaacagtgaggtgaagggagccctgaaa
cggtggctggggacgtgtgtaaacataaaacaccagcaaaatgaggcccacaggtcaaga
tga

DBGET integrated database retrieval system