KEGG   Homo sapiens (human): 3912Help
Entry
3912              CDS       T01001                                 

Gene name
LAMB1, CLM, LIS5
Definition
laminin, beta 1
Orthology
K05636  
laminin, beta 1
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3912 (LAMB1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3912 (LAMB1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3912 (LAMB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3912 (LAMB1)
   05222 Small cell lung cancer
    3912 (LAMB1)
  Infectious diseases
   05146 Amoebiasis
    3912 (LAMB1)
   05145 Toxoplasmosis
    3912 (LAMB1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      3912 (LAMB1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      3912 (LAMB1)
     Laminin-2 Extracellular matrix (ECM) components
      3912 (LAMB1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      3912 (LAMB1)
   VLA-3
      3912 (LAMB1)
     Laminin-10 Extracellular matrix (ECM) components
      3912 (LAMB1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      3912 (LAMB1)
     Laminin-8 Extracellular matrix (ECM) components
      3912 (LAMB1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      3912 (LAMB1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      3912 (LAMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22
AA seq 1786 aa AA seqDB search
MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctccagttgctagctttcagtttcttagccctgtgcagagcccgagtgcgc
gctcaggaacccgagttcagctacggctgcgcagaaggcagctgctatcccgccacgggc
gaccttctcatcggccgagcacagaagctttcggtgacctcgacgtgcgggctgcacaag
cccgaaccctactgtatcgtcagccacttgcaggaggacaaaaaatgcttcatatgcaat
tcccaagatccttatcatgagaccctgaatcctgacagccatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccagctgctatgctgatagaacgatcgtccgactttgggaaaacctgg
ggtgtgtatagatacttcgcctatgactgtgaggcctcgtttccaggcatttcaactggc
cccatgaaaaaagtcgatgacataatttgtgattctcgatattctgacattgaaccctca
actgaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agcccaaggatacagaatttattaaaaattaccaacttgagaatcaagtttgtgaaactg
catactttgggagataaccttctggattccaggatggaaatcagagaaaagtattattat
gcagtttatgatatggtggttcgaggaaattgcttctgctatggtcatgccagcgaatgt
gcccctgtggatggattcaatgaagaagtggaaggaatggttcacggacactgcatgtgc
aggcataacaccaagggcttaaactgtgaactctgcatggatttctaccatgatttacct
tggagacctgctgaaggccgaaacagcaacgcctgtaaaaaatgtaactgcaatgaacat
tccatctcttgtcactttgacatggctgtttacctggccacggggaacgtcagcggaggc
gtgtgtgatgactgtcagcacaacaccatggggcgcaactgtgagcagtgcaagccgttt
tactaccagcacccagagagggacatccgagatcctaatttctgtgaacgatgtacgtgt
gacccagctggctctcaaaatgagggaatttgtgacagctatactgatttttctactggt
ctcattgctggccagtgtcggtgtaaattaaatgtggaaggagaacattgtgatgtttgc
aaagaaggcttctatgatttaagcagtgaagatccatttggttgtaaatcttgtgcttgc
aatcctctgggaacaattcctggagggaatccttgtgattccgagacaggtcactgctac
tgcaagcgtctggtgacaggacagcattgtgaccagtgcctgccagagcactggggctta
agcaatgatttggatggatgtcgaccatgtgactgtgaccttgggggagccttaaacaac
agttgctttgcggagtcaggccagtgctcatgccggcctcacatgattggacgtcagtgc
aacgaagtggaacctggttactactttgccaccctggatcactacctctatgaagcggag
gaagccaacttggggcctggggttagcatagtggagcggcaatatatccaggaccggatt
ccctcctggactggagccggcttcgtccgagtgcctgaaggggcttatttggagtttttc
attgacaacataccatattccatggagtacgacatcctaattcgctacgagccacagcta
cccgaccactgggaaaaagctgtcatcacagtgcagcgacctggaaggattccaaccagc
agccgatgtggtaataccatccccgatgatgacaaccaggtggtgtcattatcaccaggc
tcaagatatgtcgtccttcctcggccggtgtgctttgagaagggaacaaactacacggtg
aggttggagctgcctcagtacacctcctctgatagcgacgtggagagcccctacacgctg
atcgattctcttgttctcatgccatactgtaaatcactggacatcttcaccgtgggaggt
tcaggagatggggtggtcaccaacagtgcctgggaaacctttcagagataccgatgtcta
gagaacagcagaagcgttgtgaaaacaccgatgacagatgtttgcagaaacatcatcttt
agcatttctgccctgttacaccagacaggcctggcttgtgaatgcgaccctcagggttcg
ttaagttccgtgtgtgatcccaacggaggccagtgccagtgccggcccaacgtggttgga
agaacctgcaacagatgtgcacctggaacttttggctttggccccagtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgccttctgcaatcccgtcactggccagtgc
cactgtttccagggagtgtatgctcggcagtgtgatcggtgcttacctgggcactggggc
tttccaagttgccagccctgccagtgcaatggccacgccgatgactgcgacccagtgact
ggggagtgcttgaactgccaggactacaccatgggtcataactgtgaaaggtgcttggct
ggttactatggcgaccccatcattgggtcaggagatcactgccgcccttgcccttgccca
gatggtcccgacagtggacgccagtttgccaggagctgctaccaagatcctgttacttta
cagcttgcctgtgtttgtgatcctggatacattggttccagatgtgacgactgtgcctca
ggatactttggcaatccatcagaagttggggggtcgtgtcagccttgccagtgtcacaac
aacattgacacgacagacccagaagcctgtgacaaggagactgggaggtgtctcaagtgc
ctgtaccacacggaaggggaacactgtcagttctgccggtttggatactatggtgatgcc
ctccagcaggactgtcgaaagtgtgtctgtaattacctgggcaccgtgcaagagcactgt
aacggctctgactgccagtgcgacaaagccactggtcagtgcttgtgtcttcctaatgtg
atcgggcagaactgtgaccgctgtgcgcccaatacctggcagctggccagtggcactggc
tgtgacccatgcaactgcaatgctgctcattccttcgggccatcttgcaatgagttcacg
gggcagtgccagtgcatgcctgggtttggaggccgcacctgcagcgagtgccaggaactc
ttctggggagaccccgacgtggagtgccgagcctgtgactgtgaccccaggggcattgag
acgccacagtgtgaccagtccacgggccagtgtgtctgcgttgagggtgttgagggtcca
cgctgtgacaagtgcacgcgagggtactcgggggtcttccctgactgcacaccctgccac
cagtgctttgctctctgggatgtgatcattgccgagctgaccaacaggacacacagattc
ctggagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgtgagactgtg
gactcggtggagaggaaagtcagcgagataaaagacatcctggcgcagagccccgcagca
gagccactgaaaaacattgggaatctctttgaggaagcagagaaactgattaaagatgtt
acagaaatgatggctcaagtagaagtgaaattatctgacacaacttcccaaagcaacagc
acagccaaagaactggattctctacagacagaagccgaaagcctagacaacactgtgaaa
gaacttgctgaacaactggaatttatcaaaaactcagatattcggggtgccttggatagc
attaccaagtatttccagatgtctcttgaggcagaggagagggtgaatgcctccaccaca
gaacccaacagcactgtggagcagtcagccctcatgagagacagagtagaagacgtgatg
atggagcgagaatcccagttcaaggaaaaacaagaggagcaggctcgcctccttgatgaa
ctggcaggcaagctacaaagcctagacctttcagccgctgccgaaatgacctgtggaaca
cccccaggggcctcctgttccgagactgaatgtggcgggccaaactgcagaactgacgaa
ggagagaggaagtgtggggggcctggctgtggtggtctggttactgttgcacacaacgcc
tggcagaaagccatggacttggaccaagatgtcctgagtgccctggctgaagtggaacag
ctctccaagatggtctctgaagcaaaactgagggcagatgaggcaaaacaaagtgctgaa
gacattctgttgaagacaaatgctaccaaagaaaaaatggacaagagcaatgaggagctg
agaaatctaatcaagcaaatcagaaactttttgacccaggatagtgctgatttggacagc
attgaagcagttgctaatgaagtattgaaaatggagatgcctagcaccccacagcagtta
cagaacttgacagaagatatacgtgaacgagttgaaagcctttctcaagtagaggttatt
cttcagcatagtgctgctgacattgccagagctgagatgttgttagaagaagctaaaaga
gcaagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagctctggaa
gaagcagaaaaggcccaggtcgcagcagagaaggcaattaaacaagcagatgaagacatt
caaggaacccagaacctgttaacttcgattgagtctgaaacagcagcttctgaggaaacc
ttgttcaacgcgtcccagcgcatcagcgagttagagaggaatgtggaagaacttaagcgg
aaagctgcccaaaactccggggaggcagaatatattgaaaaagtagtatatactgtgaag
caaagtgcagaagatgttaagaagactttagatggtgaacttgatgaaaagtataaaaaa
gtagaaaatttaattgccaaaaaaactgaagagtcagctgatgccagaaggaaagccgaa
atgctacaaaatgaagcaaaaactcttttagctcaagcaaatagcaagctgcaactgctc
aaagatttagaaagaaaatatgaagacaatcaaagatacttagaagataaagctcaagaa
ttagcaagactggaaggagaagtccgttcactcctaaaggatataagccagaaagttgct
gtgtatagcacatgcttgtaa

DBGET integrated database retrieval system