KEGG   Homo sapiens (human): 392Help
Entry
392               CDS       T01001                                 

Gene name
ARHGAP1, CDC42GAP, RHOGAP, RHOGAP1, p50rhoGAP
Definition
(RefSeq) Rho GTPase activating protein 1
  KO
K18470  Rho GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    392 (ARHGAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP CRAL_TRIO_2 CRAL_TRIO
Motif
Other DBs
NCBI-GeneID: 392
NCBI-ProteinID: NP_004299
OMIM: 602732
HGNC: 673
Ensembl: ENSG00000175220
Vega: OTTHUMG00000166567
Pharos: Q07960(Tbio)
UniProt: Q07960
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 439 aa AA seqDB search
MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISF
KFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTL
PEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
KFLLDHQGELFPSPDPSGL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggatccgctctcagagctgcaggatgatctgaccttggatgacaccagcgaggctctg
aaccagctgaagctggcctccatcgatgagaagaactggccctcggatgaaatgcctgac
ttccccaagtcagatgactccaaaagcagctccccggaacttgtcacacacctgaagtgg
gatgacccatactatgacatcgcccggcaccagatcgtggaggtggcaggagatgacaag
tatgggcggaagatcattgtgtttagtgcctgtcgaatgccccccagccaccagctcgac
cacagcaagctcctggggtacctgaagcacaccctggaccagtacgtggagagtgactac
acacttctgtatctgcaccacggcctgaccagcgacaacaagccctccctcagctggctc
cgtgatgcctaccgggagtttgaccgcaagtacaagaagaacatcaaggccttgtacatc
gtgcatccaaccatgttcatcaaaactctgctcatcctcttcaagcccctcatcagcttc
aagttcgggcagaagatcttctatgtgaattacctgagcgagctgagcgagcacgtgaag
ctggagcagctggggatccctcgccaagtgctcaaatatgacgacttcctgaaatccaca
cagaagagccccgcgacagcccccaagcccatgcccccacggccccccctgcccaaccag
cagtttggagtctcgctgcagcacctccaggagaagaatccagagcaggagcccattccc
attgtactcagggagactgttgcctacttacaggcccacgctctcaccaccgagggcatc
ttccggaggtcggccaacacccaagtggtccgggaagtgcagcagaagtacaacatgggg
ctgcctgtggatttcgaccagtacaatgagctgcacctgccagcagtcatcctcaagacc
ttcctccgggagcttcctgagcccctgctcacctttgacctctacccccatgtggtgggc
ttcctcaacattgatgaaagccagagggtgccagcgacactgcaggtcctccagacgctg
cccgaggagaactaccaggtgcttcgtttcctgactgctttcctggtgcagatttctgca
cacagtgaccagaacaagatgaccaacactaacctggctgttgttttcggccctaacctg
ctgtgggccaaggatgcggccatcaccctcaaggccattaatcccatcaacaccttcacc
aagttccttctggatcaccaaggggagctgttcccaagcccggaccccagcgggctctga

DBGET integrated database retrieval system