KEGG   Homo sapiens (human): 392Help
Entry
392               CDS       T01001                                 

Gene name
ARHGAP1, CDC42GAP, RHOGAP, RHOGAP1, p50rhoGAP
Definition
(RefSeq) Rho GTPase activating protein 1
  KO
K18470  
Rho GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 439 aa AA seqDB search
MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISF
KFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTL
PEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
KFLLDHQGELFPSPDPSGL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggatccgctctcagagctgcaggatgatctgaccttggatgacaccagcgaggctctg
aaccagctgaagctggcctccatcgatgagaagaactggccctcggatgaaatgcctgac
ttccccaagtcagatgactccaaaagcagctccccggaacttgtcacacacctgaagtgg
gatgacccatactatgacatcgcccggcaccagatcgtggaggtggcaggagatgacaag
tatgggcggaagatcattgtgtttagtgcctgtcgaatgccccccagccaccagctcgac
cacagcaagctcctggggtacctgaagcacaccctggaccagtacgtggagagtgactac
acacttctgtatctgcaccacggcctgaccagcgacaacaagccctccctcagctggctc
cgtgatgcctaccgggagtttgaccgcaagtacaagaagaacatcaaggccttgtacatc
gtgcatccaaccatgttcatcaaaactctgctcatcctcttcaagcccctcatcagcttc
aagttcgggcagaagatcttctatgtgaattacctgagcgagctgagcgagcacgtgaag
ctggagcagctggggatccctcgccaagtgctcaaatatgacgacttcctgaaatccaca
cagaagagccccgcgacagcccccaagcccatgcccccacggccccccctgcccaaccag
cagtttggagtctcgctgcagcacctccaggagaagaatccagagcaggagcccattccc
attgtactcagggagactgttgcctacttacaggcccacgctctcaccaccgagggcatc
ttccggaggtcggccaacacccaagtggtccgggaagtgcagcagaagtacaacatgggg
ctgcctgtggatttcgaccagtacaatgagctgcacctgccagcagtcatcctcaagacc
ttcctccgggagcttcctgagcccctgctcacctttgacctctacccccatgtggtgggc
ttcctcaacattgatgaaagccagagggtgccagcgacactgcaggtcctccagacgctg
cccgaggagaactaccaggtgcttcgtttcctgactgctttcctggtgcagatttctgca
cacagtgaccagaacaagatgaccaacactaacctggctgttgttttcggccctaacctg
ctgtgggccaaggatgcggccatcaccctcaaggccattaatcccatcaacaccttcacc
aagttccttctggatcaccaaggggagctgttcccaagcccggaccccagcgggctctga

DBGET integrated database retrieval system