KEGG   Homo sapiens (human): 3920Help
Entry
3920              CDS       T01001                                 

Gene name
LAMP2, CD107b, LAMP-2, LAMPB, LGP110
Definition
lysosomal-associated membrane protein 2
Orthology
K06528  
lysosomal-associated membrane protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Phagosome
Tuberculosis
Disease
H00150  
Danon disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3920 (LAMP2)
   04142 Lysosome
    3920 (LAMP2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3920 (LAMP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   3920 (LAMP2)
Cellular antigens [BR:hsa04090]
 Proteins
  3920 (LAMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq24
AA seq 411 aa AA seqDB search
MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKT
YKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNT
GDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNG
TVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQ
LNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN
ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQG
KYSTAEECSADSDLNFLIPVAVGVALGFLIIVVFISYMIGRRKSRTGYQSV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcttccgcctcttcccggttccgggctcagggctcgttctggtctgcctagtc
ctgggagctgtgcggtcttatgcattggaacttaatttgacagattcagaaaatgccact
tgcctttatgcaaaatggcagatgaatttcacagtacgctatgaaactacaaataaaact
tataaaactgtaaccatttcagaccatggcactgtgacatataatggaagcatttgtggg
gatgatcagaatggtcccaaaatagcagtgcagttcggacctggcttttcctggattgcg
aattttaccaaggcagcatctacttattcaattgacagcgtctcattttcctacaacact
ggtgataacacaacatttcctgatgctgaagataaaggaattcttactgttgatgaactt
ttggccatcagaattccattgaatgacctttttagatgcaatagtttatcaactttggaa
aagaatgatgttgtccaacactactgggatgttcttgtacaagcttttgtccaaaatggc
acagtgagcacaaatgagttcctgtgtgataaagacaaaacttcaacagtggcacccacc
atacacaccactgtgccatctcctactacaacacctactccaaaggaaaaaccagaagct
ggaacctattcagttaataatggcaatgatacttgtctgctggctaccatggggctgcag
ctgaacatcactcaggataaggttgcttcagttattaacatcaaccccaatacaactcac
tccacaggcagctgccgttctcacactgctctacttagactcaatagcagcaccattaag
tatctagactttgtctttgctgtgaaaaatgaaaaccgattttatctgaaggaagtgaac
atcagcatgtatttggttaatggctccgttttcagcattgcaaataacaatctcagctac
tgggatgcccccctgggaagttcttatatgtgcaacaaagagcagactgtttcagtgtct
ggagcatttcagataaatacctttgatctaagggttcagcctttcaatgtgacacaagga
aagtattctacagctgaagaatgttctgctgactctgacctcaactttcttattcctgtt
gcagtgggtgtggccttgggcttccttataattgttgtctttatctcttatatgattgga
agaaggaaaagtcgtactggttatcagtctgtgtaa

DBGET integrated database retrieval system