KEGG   Homo sapiens (human): 392138Help
Entry
392138            CDS       T01001                                 

Gene name
OR2A25, OR2A24P, OR2A25P, OR2A27
Definition
olfactory receptor, family 2, subfamily A, member 25
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 310 aa AA seqDB search
MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF
FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD
RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI
MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC
SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL
KRMLEKKRTS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggggggaaatcagacttccatcacagagttcctcctactgggatttcccattggccca
aggattcagatgctcctctttgggctcttctccctgttctacatcttcattctgttgggg
aacgggacaatcctggggctcatctcactggactccagactccacacccccatgtacttc
ttcctctcacacctggcggtcgtcgacatcgcctgtgcttgcagcacggtgccccagatg
ctggtgaacctcctgcatccagccaagcccatctcctttgctggctgcatgacccagatg
tttctgtttttgagttttgcacatacagaatgtctcctcctggtggtgatgtcctatgat
cggtacgtggccatctgccaccctctccgatattctaccatcatgacctggaaagtctgc
atcactttggcattgacttcctggattttaggagtcttattggcccttgtccatctagtg
ttactgctaccactgtccttctgtggaccccagaaacttaatcactttttctgtgaaatt
atggctgttctcaaacttgcctgtgcggatacccacattaatgaggtaatggttttggca
ggggcagtgtctgtgctggtgggagccttcttttccactgtaatatcttatgttcatatt
ctatgtgccattctaaagatccagtcaggagaggggtgccagaaagccttctccatctgc
tcctcccacctctgtgtggttggactcttttatggcacagccatcatcatgtatgttgag
ccccagtatgagagccccaaggagcagaagaaatatctcctgctgtttcacagcctcttc
aatcccatgcttaatcccctaatttatagtcttaggaacaaggaagtccaaggtactcta
aagaggatgcttgaaaagaagagaacttcatga

DBGET integrated database retrieval system