KEGG   Homo sapiens (human): 392138Help
Entry
392138            CDS       T01001                                 

Gene name
OR2A25, OR2A24P, OR2A25P, OR2A27
Definition
(RefSeq) olfactory receptor family 2 subfamily A member 25
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    392138 (OR2A25)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    392138 (OR2A25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 392138
NCBI-ProteinID: NP_001004488
HGNC: 19562
Ensembl: ENSG00000221933
Vega: OTTHUMG00000158013
Pharos: A4D2G3(Tdark)
UniProt: A4D2G3 A0A126GVV5
Position
7q35
AA seq 310 aa AA seqDB search
MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF
FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD
RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI
MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC
SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL
KRMLEKKRTS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggggggaaatcagacttccatcacagagttcctcctactgggatttcccattggccca
aggattcagatgctcctctttgggctcttctccctgttctacatcttcattctgttgggg
aacgggacaatcctggggctcatctcactggactccagactccacacccccatgtacttc
ttcctctcacacctggcggtcgtcgacatcgcctgtgcttgcagcacggtgccccagatg
ctggtgaacctcctgcatccagccaagcccatctcctttgctggctgcatgacccagatg
tttctgtttttgagttttgcacatacagaatgtctcctcctggtggtgatgtcctatgat
cggtacgtggccatctgccaccctctccgatattctaccatcatgacctggaaagtctgc
atcactttggcattgacttcctggattttaggagtcttattggcccttgtccatctagtg
ttactgctaccactgtccttctgtggaccccagaaacttaatcactttttctgtgaaatt
atggctgttctcaaacttgcctgtgcggatacccacattaatgaggtaatggttttggca
ggggcagtgtctgtgctggtgggagccttcttttccactgtaatatcttatgttcatatt
ctatgtgccattctaaagatccagtcaggagaggggtgccagaaagccttctccatctgc
tcctcccacctctgtgtggttggactcttttatggcacagccatcatcatgtatgttgag
ccccagtatgagagccccaaggagcagaagaaatatctcctgctgtttcacagcctcttc
aatcccatgcttaatcccctaatttatagtcttaggaacaaggaagtccaaggtactcta
aagaggatgcttgaaaagaagagaacttcatga

DBGET integrated database retrieval system