KEGG   Homo sapiens (human): 392390Help
Entry
392390            CDS       T01001                                 

Gene name
OR1L6, HG16, OR1L7, OR9-30
Definition
olfactory receptor, family 1, subfamily L, member 6
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.2
AA seq 311 aa AA seqDB search
MEIKNYSSSTSGFILLGLSSNPQLQKPLFAIFLIMYLLAAVGNVLIIPAIYSDPRLHTPM
YFFLSNLSFMDICFTTVIVPKMLVNFLSETKVISYVGCLAQMYFFMAFGNTDSYLLASMA
IDRLVAICNPLHYDVVMKPRHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFC
DTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFS
TCGSHLTAVALFYGSIIYVYFRPLSMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKR
GLKKLQDRIYR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagataaagaactacagcagcagcacctcaggcttcatcctcctgggcctctcttcc
aaccctcagctgcagaaacctctctttgccatcttcctcatcatgtacctgctcgctgcg
gtggggaatgtgctcatcatcccggccatctactctgaccccaggctccacacccctatg
tacttttttctcagcaacttgtctttcatggatatctgcttcacaacagtcatagtgcct
aagatgctggtgaattttctatcagagacaaaggttatctcctatgtgggctgcctggcc
cagatgtacttctttatggcatttgggaacactgacagctacctgctggcctctatggcc
atcgaccggctggtggccatctgcaaccccttacactatgatgtggttatgaaaccacgg
cattgcctgctcatgctattgggttcttgcagcatctcccacctacattccctgttccgc
gtgctacttatgtctcgcttgtctttctgtgcctctcacatcattaagcactttttctgt
gacacccagcctgtgctaaagctctcctgctctgacacatcctccagccagatggtggtg
atgactgagaccttagctgtcattgtgacccccttcctgtgtatcatcttctcctacctg
cgaatcatggtcactgtgctcagaatcccctctgcagccgggaagtggaaggccttctct
acctgtggctcccacctcactgcagtagcccttttctatgggagtattatttatgtctat
tttaggcccctgtccatgtactcagtggttagggaccgggtagccacagttatgtacaca
gtagtgacacccatgctgaaccctttcatctacagcctgaggaacaaagatatgaagagg
ggtttgaagaaattacaggacagaatttaccggtaa

DBGET integrated database retrieval system