KEGG   Homo sapiens (human): 3925Help
Entry
3925              CDS       T01001                                 

Gene name
STMN1, C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN
Definition
stathmin 1
Orthology
K04381  
stathmin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3925 (STMN1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3925 (STMN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.11
AA seq 174 aa AA seqDB search
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKMYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctgatatccaggtgaaagaactggagaagcgtgcctcaggccaggctttt
gagctgattctcagccctcggtcaaaagaatctgttccagaattccccctttcccctcca
aagaagaaggatctttccctggaggaaattcagaagaaattagaagctgcagaagaaaga
cgcaagtcccatgaagctgaggtcttgaagcagctggctgagaaacgagagcacgagaaa
gaagtgcttcagaaggcaatagaagagaacaacaacttcagtaaaatggcagaagagaaa
ctgacccacaaaatggaagctaataaagagaaccgagaggcacaaatggctgccaaactg
gaacgtttgcgagagaagatgtacttctggactcacgggcctggggcccacccagcacag
atctctgctgagcaatcttgtctccactctgttcctgccctttgcccagccctgggcctc
caatctgcattgattacctggtctgatctctctcaccatcactag

DBGET integrated database retrieval system