KEGG   Homo sapiens (human): 3927Help
Entry
3927              CDS       T01001                                 

Gene name
LASP1, Lasp-1, MLN50
Definition
(RefSeq) LIM and SH3 protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11-q21.3
AA seq 261 aa AA seqDB search
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVA
QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM
YGTVERTGDTGMLPANYVEAI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaactgcgcccggtgcggcaagatcgtgtatcccacggagaaggtgaactgt
ctggataagttctggcataaagcatgcttccattgcgagacctgcaagatgacactgaac
atgaagaactacaagggctacgagaagaagccctactgcaacgcacactaccccaagcag
tccttcaccatggtggcggacaccccggaaaaccttcgcctcaagcaacagagtgagctc
cagagtcaggtgcgctacaaggaggagtttgagaagaacaagggcaaaggtttcagcgta
gtggcagacacgcccgagctccagagaatcaagaagacccaggaccagatcagtaacata
aaataccatgaggagtttgagaagagccgcatgggccctagcgggggcgagggcatggag
ccagagcgtcgggattcacaggacggcagcagctaccggcggcccctggagcagcagcag
cctcaccacatcccgaccagtgccccggtttaccagcagccccagcagcagccggtggcc
cagtcctatggtggctacaaggagcctgcagccccagtctccatacagcgcagcgcccca
ggtggtggcgggaagcggtaccgcgcggtgtatgactacagcgccgccgacgaggacgag
gtctccttccaggacggggacaccatcgtcaacgtgcagcagatcgacgacggctggatg
tacgggacggtggagcgcaccggcgacacggggatgctgccggccaactacgtggaggcc
atctga

DBGET integrated database retrieval system