KEGG   Homo sapiens (human): 393046Help
Entry
393046            CDS       T01001                                 

Gene name
OR2A5, OR2A11P, OR2A26, OR2A8, OR7-138, OR7-141
Definition
olfactory receptor, family 2, subfamily A, member 5
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    393046 (OR2A5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    393046 (OR2A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 311 aa AA seqDB search
MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWLDSRLHTPMYF
FLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQTFLYMAFAHTECLILVMMSY
DRYMAICHPLQYSVIMRWGVCTVLAVTSWACGSLLALVHVVLILRLPFCGPHEINHFFCE
ILSVLKLACADTWLNQVVIFAASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFST
CSSHLCMVGLFFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGA
LKRVLWKQRSK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaatcagacatgggtcacagaattcattctcctgggatttccactcagccta
aggattcagatgctcctctctgggcttttctccctgttatacgtcttcaccctgctggga
aatggggccatcctggggctcatctggctggactccagactgcacacccccatgtacttc
tttctctcacacctggccatcattgatatttcgtatgcttccaacaatgtccccaagatg
ctgacaaaccttggcttgaacaagagaaaaacaatctcctttgtcccatgcacaatgcag
acctttttatacatggcttttgctcacactgagtgtctcatcttggtaatgatgtcctac
gatcggtacatggctatctgccaccctctgcaatattctgtcatcatgagatggggagtg
tgcacagtcctggctgtcacttcttgggcatgtggttcccttctggccctggtccatgtg
gttctcatcctgaggctgcccttctgtgggccccatgaaatcaaccacttcttctgtgaa
atcctgtctgtcctcaagttggcctgtgctgacacctggctcaaccaggtggtcatcttt
gctgcttcagtgttcatcctggtggggccgctctgcctggtgctggtctcctactcgcgc
atcctggcggccatcttgaggatccagtctggggagggccgcagaaaggccttctccacc
tgctcctcccacctttgcatggtgggactcttctttggcagcgccattgtcatgtacatg
gcccccaagtcccgccaccctgaggagcagcagaaggtcctttccctgttttacagcctt
ttcaacccgatgctgaaccccttgatctatagcctgaggaacgcagaggtcaagggtgcc
ctgaaaagagtgttgtggaaacagagatcaaagtga

DBGET integrated database retrieval system