KEGG   Homo sapiens (human): 394Help
Entry
394               CDS       T01001                                 

Gene name
ARHGAP5, GFI2, RhoGAP5, p190-B, p190BRhoGAP
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    394 (ARHGAP5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    394 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q12
AA seq 1502 aa AA seqDB search
MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPANKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINL
VSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPV
NYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVET
FIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLG
II
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgtcccccatcctataccatcagtatagttggactc
tctgggactgaaaaagacaaaggtaactgtggagttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaacaatgatcactttttgtactggggtgacataatacaa
aatagtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcatctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcagctaggctta
gaacaagactttgaacagaagcaaatgcctgaagggaagctcaacgtagatggattttta
ttatgcattgatgtaagtcaaggatgcaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccagttatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgcgtggatcattatcttagagaagttcaggcatttgcttcaaataaaaag
aaccttcttgtagtggaaacatcagcacgatttaatgtcaacattgaaacatgttttact
gcactggtacaaatgttggataaaactcgtagcaagcctaaaattattccctatttggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagtttgaaaaacttgtg
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacattctca
aaacatatagaacaacttaaacaggaacatataagaaaaaggagagaagagtatataaat
actttaccaagagcttttaacactcttttgccaaatctagaagagattgaacatttgaat
tggtcagaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtg
ctagaaaaaactccttgggatgaaactgaccatatagacaaaattaatgataggcggatt
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacagcat
ctgatatccgagaagaggagggtggaaatgaaggaaaaattcaaaaagactttggaaaaa
attcaattcatttcaccagggcagccatgggaggaagttatgtgctttgttatggaggat
gaagcctacaaatatatcactgaggctgatagcaaagaggtatatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaagaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttctgagtgaagaacctagatataaagctttacagaaacttgcacctgatagggaatcc
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgtcttagtggc
caaaattgtacagacattaaagtggagcagttacttgctagtagtcttttacagttggat
catggccgcttaagattatatcacgatagtaccaatatagataaagttaacctttttatt
ttagggaaggatggccttgcccaagaactagcaaatgagataaggacacaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggccggttgatgccaaa
tcgccttactttttgagtcagttatggactgccgcctttaaaccacatgggtgcttctgt
gtatttaattccattgagtcattgagttttattggggaatttattgggaaaataagaact
gaagcttctcagatcagaaaagataaatacatggctaatcttccatttacattaattctg
gctaatcagagagattccattagtaagaatctaccaattctcaggcaccaagggcagcag
ttggcaaacaagttgcaatgtccttttgtagatgtacctgctggtacatatcctcgtaaa
tttaatgaaacccaaataaagcaagctctcagaggagtattggaatcagttaaacacaat
ttggatgtggtgagcccaattcctgccaataaggacttatcagaagctgacttgagaatt
gtcatgtgcgccatgtgtggagatccatttagtgtggatcttattctttcacccttcctt
gattctcattcttgcagtgctgctcaagctggacagaataattccctaatgcttgataaa
atcattggtgaaaaaaggaggcgaatacagatcacaatattatcataccactcttcaatt
ggagtaagaaaagatgaactagttcatgggtatatattagtttactctgcaaaacggaaa
gcttcgatgggaatgcttcgagcatttctatcagaagttcaagacaccattcctgtacag
ctggtggcagttactgacagccaagcagatttttttgaaaatgaggctatcaaagagtta
atgactgaaggagaacacattgcaactgagatcactgctaaatttacagcactgtattct
ttatctcagtatcatcggcaaactgaggtctttactctgttttttagtgatgttctagag
aaaaaaaatatgatagaaaattcttatttgtctgataatacaagggaatcaacccatcaa
agtgaagatgtttttctaccatctcccagagactgttttccctataataactaccctgat
tcagatgatgacacagaagcaccacctccttatagtccaattggggatgatgtacagttg
cttccaacacctagtgaccgttccagatatagattagatttggaaggaaatgagtatcct
attcatagtaccccaaactgtcatgaccatgaacgcaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaagacaaatgtgaaaaaactcgatccaaaccttttaaaa
acaattgaagctggtattggtaaaaatccaagaaagcagacttcccgggtgcctttggca
catcctgaagatatggatccttcagataactatgcggaacccattgatacaattttcaaa
cagaagggctattctgatgagatttatgttgtcccagatgatagtcaaaatcgtattaaa
attcgaaactcatttgtaaataacacccaaggagatgaagaaaatgggttttctgataga
acctcaaaaagtcatggggaacggaggccttcaaaatacaaatataaatctaaaaccttg
tttagtaaagccaagtcatactatagaagaacacattcagatgccagtgatgatgaggct
ttcaccacttctaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatccactt
ctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacttctgaccag
gagttagatgataagaagatgaagaagaaaacccacaaagtgaaagaagataaaaagcag
aaaaagaaaactaagaacttcaatccaccaacacgtagaaattgggaaagtaattacttt
gggatgcccctccaggatctggttacagctgagaagcccataccactatttgttgagaaa
tgtgtggaatttattgaagatacagggttatgtaccgaaggactctaccgtgtcagcggg
aataaaactgaccaagacaatattcaaaagcagtttgatcaagatcataatatcaatcta
gtgtcaatggaagtaacagtaaatgctgtagctggagcccttaaagctttctttgcagat
ctgccagatcctttaattccatattctcttcatccagaactattggaagcagcaaaaatc
ccggataaaacagaacgtcttcatgccttgaaagaaattgttaagaaatttcatcctgta
aactatgatgtattcagatacgtgataacacatctaaacagggttagtcagcaacataaa
atcaacctaatgacagcagacaacttatccatctgtttttggccaaccttgatgagacct
gattttgaaaatcgagagtttctgtctactactaagattcatcaatctgttgttgaaaca
ttcattcagcagtgtcagtttttcttttacaatggagaaattgtagaaacgacaaacatt
gtggctcctccaccaccttcaaacccaggacagttggtggaaccaatggtgccacttcag
ttgccgccaccattgcaacctcagctgatacaaccacaattacaaacggatcctcttggt
attatatga

DBGET integrated database retrieval system