KEGG   Homo sapiens (human): 3952Help
Entry
3952              CDS       T01001                                 

Gene name
LEP, LEPD, OB, OBS
Definition
leptin
Orthology
K05424  
leptin
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.3
AA seq 167 aa AA seqDB search
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcattggggaaccctgtgcggattcttgtggctttggccctatcttttctatgtccaa
gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaagtcaccggtttg
gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca
gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac
ctggagaacctccgggatcttcttcacgtgctggccttctctaagagctgccacttgccc
tgggccagtggcctggagaccttggacagcctggggggtgtcctggaagcttcaggctac
tccacagaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

DBGET integrated database retrieval system