KEGG   Homo sapiens (human): 3953Help
Entry
3953              CDS       T01001                                 

Gene name
LEPR, CD295, LEP-R, LEPRD, OB-R, OBR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04152  AMPK signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Disease
H02060  Leptin receptor deficiency
Drug target
Metreleptin: D05014
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3953 (LEPR)
   04152 AMPK signaling pathway
    3953 (LEPR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3953 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    3953 (LEPR)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    3953 (LEPR)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3953 (LEPR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   3953 (LEPR)
CD molecules [BR:hsa04090]
 Proteins
  3953 (LEPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lep_receptor_Ig fn3
Motif
Other DBs
NCBI-GeneID: 3953
NCBI-ProteinID: NP_002294
OMIM: 601007
HGNC: 6554
Ensembl: ENSG00000116678
Vega: OTTHUMG00000009115
Pharos: P48357(Tclin)
UniProt: P48357
Structure
PDB: 

Jmol
Position
1p31.3
AA seq 1165 aa AA seqDB search
MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNS
NGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVF
QQIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGS
FQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPP
LGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTVIREADKIVSATSLLVDSILP
GSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKI
VPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIH
PISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPP
SSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPV
PDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNV
TLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSI
GASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYFIIEWKNLNED
GEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDA
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTASVTCGPLLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFN
SVNFSEAEGTEVTYEDESQRQPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPL
KDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDKKSIYYL
GVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSCSHFVENNINLGTSSKKTFAS
YMPQFQTCSTQTHKIMENKMCDLTV
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggttttgttacattgggaatttatttatgtgataact
gcgtttaacttgtcatatccaattactccttggagatttaagttgtcttgcatgccacca
aattcaacctatgactacttccttttgcctgctggactctcaaagaatacttcaaattcg
aatggacattatgagacagctgttgaacctaagtttaattcaagtggtactcacttttct
aacttatccaaaacaactttccactgttgctttcggagtgagcaagatagaaactgctcc
ttatgtgcagacaacattgaaggaaagacatttgtttcaacagtaaattctttagttttt
caacaaatagatgcaaactggaacatacagtgctggctaaaaggagacttaaaattattc
atctgttatgtggagtcattatttaagaatctattcaggaattataactataaggtccat
cttttatatgttctgcctgaagtgttagaagattcacctctggttccccaaaaaggcagt
tttcagatggttcactgcaattgcagtgttcatgaatgttgtgaatgtcttgtgcctgtg
ccaacagccaaactcaacgacactctccttatgtgtttgaaaatcacatctggtggagta
attttccagtcacctctaatgtcagttcagcccataaatatggtgaagcctgatccacca
ttaggtttgcatatggaaatcacagatgatggtaatttaaagatttcttggtccagccca
ccattggtaccatttccacttcaatatcaagtgaaatattcagagaattctacaacagtt
atcagagaagctgacaagattgtctcagctacatccctgctagtagacagtatacttcct
gggtcttcgtatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagtactcctcgtgtctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgttgggtctaatgtttcttttcactgcatctataagaaggaaaacaagatt
gttccctcaaaagagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgtgagtgatcatgttagcaaagttacttttttcaatctgaatgaaaccaaa
cctcgaggaaagtttacctatgatgcagtgtactgctgcaatgaacatgaatgccatcat
cgctatgctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcaaccagtacaatccagtcacttgcggaaagc
actttgcaattgaggtatcataggagcagcctttactgttctgatattccatctattcat
cccatatctgagcccaaagattgctatttgcagagtgatggtttttatgaatgcattttc
cagccaatcttcctattatctggctacacaatgtggattaggatcaatcactctctaggt
tcacttgactctccaccaacatgtgtccttcctgattctgtggtgaagccactgcctcca
tccagtgtgaaagcagaaattactataaacattggattattgaaaatatcttgggaaaag
ccagtctttccagagaataaccttcaattccagattcgctatggtttaagtggaaaagaa
gtacaatggaagatgtatgaggtttatgatgcaaaatcaaaatctgtcagtctcccagtt
ccagacttgtgtgcagtctatgctgttcaggtgcgctgtaagaggctagatggactggga
tattggagtaattggagcaatccagcctacacagttgtcatggatataaaagttcctatg
agaggacctgaattttggagaataattaatggagatactatgaaaaaggagaaaaatgtc
actttactttggaagcccctgatgaaaaatgactcattgtgcagtgttcagagatatgtg
ataaaccatcatacttcctgcaatggaacatggtcagaagatgtgggaaatcacacgaaa
ttcactttcctgtggacagagcaagcacatactgttacggttctggccatcaattcaatt
ggtgcttctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatc
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattgtttcctggatacta
tcacccagtgattacaagctaatgtattttattattgagtggaaaaatcttaatgaagat
ggtgaaataaaatggcttagaatctcttcatctgttaagaagtattatatccatgatcat
tttatccccattgagaagtaccagttcagtctttacccaatatttatggaaggagtggga
aaaccaaagataattaatagtttcactcaagatgatattgaaaaacaccagagtgatgca
ggtttatatgtaattgtgccagtaattatttcctcttccatcttattgcttggaacatta
ttaatatcacaccaaagaatgaaaaagctattttgggaagatgttccgaaccccaagaat
tgttcctgggcacaaggacttaattttcagaagccagaaacgtttgagcatctttttatc
aagcatacagcatcagtgacatgtggtcctcttcttttggagcctgaaacaatttcagaa
gatatcagtgttgatacatcatggaaaaataaagatgagatgatgccaacaactgtggtc
tctctactttcaacaacagatcttgaaaagggttctgtttgtattagtgaccagttcaac
agtgttaacttctctgaggctgagggtactgaggtaacctatgaggacgaaagccagaga
caaccctttgttaaatacgccacgctgatcagcaactctaaaccaagtgaaactggtgaa
gaacaagggcttataaatagttcagtcaccaagtgcttctctagcaaaaattctccgttg
aaggattctttctctaatagctcatgggagatagaggcccaggcattttttatattatca
gatcagcatcccaacataatttcaccacacctcacattctcagaaggattggatgaactt
ttgaaattggagggaaatttccctgaagaaaataatgataaaaagtctatctattattta
ggggtcacctcaatcaaaaagagagagagtggtgtgcttttgactgacaagtcaagggta
tcgtgcccattcccagccccctgtttattcacggacatcagagttctccaggacagttgc
tcacactttgtagaaaataatatcaacttaggaacttctagtaagaagacttttgcatct
tacatgcctcaattccaaacttgttctactcagactcataagatcatggaaaacaagatg
tgtgacctaactgtgtaa

DBGET integrated database retrieval system