KEGG   Homo sapiens (human): 3953Help
Entry
3953              CDS       T01001                                 

Gene name
LEPR, CD295, LEP-R, LEPRD, OB-R, OBR
Definition
leptin receptor
Orthology
K05062  
leptin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
AMPK signaling pathway
Jak-STAT signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3953 (LEPR)
   04152 AMPK signaling pathway
    3953 (LEPR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3953 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    3953 (LEPR)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    3953 (LEPR)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3953 (LEPR)
Cellular antigens [BR:hsa04090]
 Proteins
  3953 (LEPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31
AA seq 896 aa AA seqDB search
MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNS
NGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVF
QQIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGS
FQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPP
LGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTVIREADKIVSATSLLVDSILP
GSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKI
VPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIH
PISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPP
SSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPV
PDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNV
TLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSI
GASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYFIIEWKNLNED
GEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDA
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKRTDIL
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggttttgttacattgggaatttatttatgtgataact
gcgtttaacttgtcatatccaattactccttggagatttaagttgtcttgcatgccacca
aattcaacctatgactacttccttttgcctgctggactctcaaagaatacttcaaattcg
aatggacattatgagacagctgttgaacctaagtttaattcaagtggtactcacttttct
aacttatccaaaacaactttccactgttgctttcggagtgagcaagatagaaactgctcc
ttatgtgcagacaacattgaaggaaagacatttgtttcaacagtaaattctttagttttt
caacaaatagatgcaaactggaacatacagtgctggctaaaaggagacttaaaattattc
atctgttatgtggagtcattatttaagaatctattcaggaattataactataaggtccat
cttttatatgttctgcctgaagtgttagaagattcacctctggttccccaaaaaggcagt
tttcagatggttcactgcaattgcagtgttcatgaatgttgtgaatgtcttgtgcctgtg
ccaacagccaaactcaacgacactctccttatgtgtttgaaaatcacatctggtggagta
attttccagtcacctctaatgtcagttcagcccataaatatggtgaagcctgatccacca
ttaggtttgcatatggaaatcacagatgatggtaatttaaagatttcttggtccagccca
ccattggtaccatttccacttcaatatcaagtgaaatattcagagaattctacaacagtt
atcagagaagctgacaagattgtctcagctacatccctgctagtagacagtatacttcct
gggtcttcgtatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagtactcctcgtgtctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgttgggtctaatgtttcttttcactgcatctataagaaggaaaacaagatt
gttccctcaaaagagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgtgagtgatcatgttagcaaagttacttttttcaatctgaatgaaaccaaa
cctcgaggaaagtttacctatgatgcagtgtactgctgcaatgaacatgaatgccatcat
cgctatgctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcaaccagtacaatccagtcacttgcggaaagc
actttgcaattgaggtatcataggagcagcctttactgttctgatattccatctattcat
cccatatctgagcccaaagattgctatttgcagagtgatggtttttatgaatgcattttc
cagccaatcttcctattatctggctacacaatgtggattaggatcaatcactctctaggt
tcacttgactctccaccaacatgtgtccttcctgattctgtggtgaagccactgcctcca
tccagtgtgaaagcagaaattactataaacattggattattgaaaatatcttgggaaaag
ccagtctttccagagaataaccttcaattccagattcgctatggtttaagtggaaaagaa
gtacaatggaagatgtatgaggtttatgatgcaaaatcaaaatctgtcagtctcccagtt
ccagacttgtgtgcagtctatgctgttcaggtgcgctgtaagaggctagatggactggga
tattggagtaattggagcaatccagcctacacagttgtcatggatataaaagttcctatg
agaggacctgaattttggagaataattaatggagatactatgaaaaaggagaaaaatgtc
actttactttggaagcccctgatgaaaaatgactcattgtgcagtgttcagagatatgtg
ataaaccatcatacttcctgcaatggaacatggtcagaagatgtgggaaatcacacgaaa
ttcactttcctgtggacagagcaagcacatactgttacggttctggccatcaattcaatt
ggtgcttctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatc
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattgtttcctggatacta
tcacccagtgattacaagctaatgtattttattattgagtggaaaaatcttaatgaagat
ggtgaaataaaatggcttagaatctcttcatctgttaagaagtattatatccatgatcat
tttatccccattgagaagtaccagttcagtctttacccaatatttatggaaggagtggga
aaaccaaagataattaatagtttcactcaagatgatattgaaaaacaccagagtgatgca
ggtttatatgtaattgtgccagtaattatttcctcttccatcttattgcttggaacatta
ttaatatcacaccaaagaatgaaaaagctattttgggaagatgttccgaaccccaagaat
tgttcctgggcacaaggacttaattttcagaagagaacggacattctttga

DBGET integrated database retrieval system