KEGG   Homo sapiens (human): 3954Help
Entry
3954              CDS       T01001                                 

Gene name
LETM1
Definition
(RefSeq) leucine zipper and EF-hand containing transmembrane protein 1
  KO
K17800  
LETM1 and EF-hand domain-containing protein 1, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    3954 (LETM1)
Transporters [BR:hsa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   3954 (LETM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 739 aa AA seqDB search
MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHP
VYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVV
EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAAR
MLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTF
ETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRETGERP
SNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDK
LIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEH
REKELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEI
TKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVE
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQV
KHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLEKEEKV
EEKEKAKEKAEKEVAEVKS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatcttactgaggagctgccgcggccgggcgcccgcccgcctcccgccgccg
cctcggtacaccgtcccgcggggtagtccaggggatcctgctcatctcagctgtgccagc
accctggggttgaggaactgcctgaatgttccatttggctgctgcactcccatccaccct
gtgtacacatcctccagaggcgatcacctcggctgttgggctctgaggcccgagtgcctt
cgcatagtgtcgagagcgccatggacctctacctctgtgggttttgtggctgtgggacct
cagtgccttcctgtgcgtggctggcactcttcgcgccctgttcgcgatgactcggtagta
gagaagtccctcaagtccttgaaggacaagaacaagaagctggaggaaggcggcccggtg
tacagcccccccgcagaggtggtggtgaagaagtccctggggcagcgggtgctggacgag
ctgaagcactactaccatggcttccgcctgctatggatcgacaccaagatcgcggcacgc
atgctctggcgcatcctcaacggccacagcctgacccgccgggagcgcaggcagtttctc
cggatctgcgctgacctcttccgcctggtgccgttccttgtgttcgtggtggtgccgttc
atggagtttctgctgcctgttgctgtgaagctcttccccaacatgttgccatccacattt
gagactcagtcactcaaggaggagaggctgaagaaggagcttcgggtcaagctggagctg
gccaagttcctccaggacaccatcgaggagatggccttgaagaacaaggcagccaagggc
agcgccaccaaagacttctctgtgtttttccagaagatccgggaaacaggggagaggccc
agcaatgaggaaatcatgcgtttttccaaattatttgaggatgagctgaccctggacaac
ctgacacggccgcagctggtggccctgtgcaagctgctggagctacagtccatcggcacc
aacaacttcctgcgcttccagcttaccatgcggctgcgctccataaaggcagacgacaag
ctgattgctgaggaaggggtggacagcctgaatgtcaaggagctgcaggcagcgtgtcgg
gcacgaggcatgcgggccctgggcgtcacggaagaccgcctgaggggtcagctgaagcag
tggctggacctgcacctgcatcaggagatccccacatcgctgctcatcctgtcccgggcc
atgtacctcccggacaccctctctccagccgaccagctcaagtccacactgcagaccctc
ccagagattgtggcaaaggaagcacaggtgaaagtggccgaggtggagggcgagcaggtg
gacaacaaggccaagctggaggccacgctgcaggaggaggcggccatccagcaggagcac
cgtgagaaggagctgcagaagcgctcggaggtggcgaaggattttgagcccgaacgtgtg
gtagctgctccccaaaggccggggaccgagccacagccagaaatgcctgacacagtcctg
cagtcagagaccttgaaggacactgccccggtgctggagggcttgaaggaggaagagatc
acgaaggaggaaatcgacatcctcagcgatgcctgctctaagctgcaggagcagaagaag
tcactcaccaaggagaaggaggagctggagctgctgaaggaggatgtgcaggactacagc
gaggacttgcaggagatcaagaaggaactttcaaagactggtgaagaaaagtacgtggaa
gaatctaaagccagcaagagattgacaaaaagggtgcagcaaatgatcgggcagatcgat
ggcttgatctcgcagctggagatggaccagcaggctggcaagctggccccggccaacggc
atgcccacgggggagaacgtcatcagtgtcgctgagctcatcaacgccatgaagcaagtc
aagcacattcccgaaagcaagctcaccagcctggccgcagcactggatgaaaacaaggat
ggcaaggtcaacatcgacgacctcgtcaaggtgattgagctggtggacaaagaagatgtt
cacatctccaccagccaggtggctgagattgtagcaacactggaaaaagaggagaaggtg
gaggagaaggagaaggccaaagagaaggcagagaaggaggtcgcagaggtgaagagctag

DBGET integrated database retrieval system