KEGG   Homo sapiens (human): 3955Help
Entry
3955              CDS       T01001                                 

Gene name
LFNG, SCDO3
Definition
LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (EC:2.4.1.222)
Orthology
K05948  
fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Notch signaling pathway
Disease
H00517  
Spondylocostal dysostosis (SCD)
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:hsa00514]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7p22.2
AA seq 379 aa AA seqDB search
MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAA
AAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVK
TTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCK
MAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERV
SENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEAL
LGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFR
SIHCHLYPDTPWCPRTAIF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgctgcggccggcgcctgctgctggcgctggcgggcgcgctgctcgcctgc
ctgctggtgctcaccgccgacccgccgccgcctccactgcccgccgagcgcggccggcgc
gcgctgcgcagcctggcgggccccgcgggggctgccccggcgcccgggctgggggcggcg
gcggcggcgcccggggcgctggtccgcgacgtgcacagtctgtccgagtacttcagcctg
ctcacccgcgcgcgcagagatgcgggcccgccgcccggggctgccccccgccccgccgac
ggccacccgcgccccctggccgagccgctcgcgccccgagacgtcttcatcgctgtcaag
accaccaaaaagttccaccgcgcgcgcctcgacctgctgctggagacctggatctcgcgc
cacaaggagatgacgttcatcttcactgacggggaagatgaggccctggccaggcacacg
ggcaacgtggtcatcacaaactgctcggccgcccacagccgccaggcgctgtcctgcaag
atggccgtggagtatgaccgcttcatcgagtccggcaggaagtggttctgccacgtggac
gatgacaactacgtcaacctgcgggccctgctgcggctgctggccagctacccgcacacg
cgggacgtctacgtcggcaagcccagcctggacaggcccatccaggccatggagcgggtc
agcgagaacaaggtgcgtcctgtccacttctggtttgccacgggcggcgctggcttctgc
atcagccgtgggctggctctgaagatgagcccgtgggccagcgggggtcacttcatgaat
acggctgagcggatccggctgcctgatgactgcaccatcggctacatcgtggaggccctg
ctgggtgtgcccctcatccgcagcggcctcttccactcccacctggagaacctgcagcag
gtgcccacctcggagctccacgagcaggtgacgctgagctacggtatgtttgaaaacaag
cggaacgccgtccacgtgaaggggcccttctcggtggaggccgacccatccaggttccgc
tccatccactgccacctgtacccggacacaccctggtgtccccgcactgccatcttctag

DBGET integrated database retrieval system