KEGG   Homo sapiens (human): 3955Help
Entry
3955              CDS       T01001                                 

Gene name
LFNG, SCDO3
Definition
LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (EC:2.4.1.222)
Orthology
K05948  
fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Notch signaling pathway
Disease
H00517  
Spondylocostal dysostosis (SCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    3955 (LFNG)
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    3955 (LFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     3955 (LFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   3955 (LFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7p22.2
AA seq 379 aa AA seqDB search
MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAA
AAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVK
TTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCK
MAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERV
SENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEAL
LGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFR
SIHCHLYPDTPWCPRTAIF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgctgcggccggcgcctgctgctggcgctggcgggcgcgctgctcgcctgc
ctgctggtgctcaccgccgacccgccgccgcctccactgcccgccgagcgcggccggcgc
gcgctgcgcagcctggcgggccccgcgggggctgccccggcgcccgggctgggggcggcg
gcggcggcgcccggggcgctggtccgcgacgtgcacagtctgtccgagtacttcagcctg
ctcacccgcgcgcgcagagatgcgggcccgccgcccggggctgccccccgccccgccgac
ggccacccgcgccccctggccgagccgctcgcgccccgagacgtcttcatcgctgtcaag
accaccaaaaagttccaccgcgcgcgcctcgacctgctgctggagacctggatctcgcgc
cacaaggagatgacgttcatcttcactgacggggaagatgaggccctggccaggcacacg
ggcaacgtggtcatcacaaactgctcggccgcccacagccgccaggcgctgtcctgcaag
atggccgtggagtatgaccgcttcatcgagtccggcaggaagtggttctgccacgtggac
gatgacaactacgtcaacctgcgggccctgctgcggctgctggccagctacccgcacacg
cgggacgtctacgtcggcaagcccagcctggacaggcccatccaggccatggagcgggtc
agcgagaacaaggtgcgtcctgtccacttctggtttgccacgggcggcgctggcttctgc
atcagccgtgggctggctctgaagatgagcccgtgggccagcgggggtcacttcatgaat
acggctgagcggatccggctgcctgatgactgcaccatcggctacatcgtggaggccctg
ctgggtgtgcccctcatccgcagcggcctcttccactcccacctggagaacctgcagcag
gtgcccacctcggagctccacgagcaggtgacgctgagctacggtatgtttgaaaacaag
cggaacgccgtccacgtgaaggggcccttctcggtggaggccgacccatccaggttccgc
tccatccactgccacctgtacccggacacaccctggtgtccccgcactgccatcttctag

DBGET integrated database retrieval system