KEGG   Homo sapiens (human): 3956Help
Entry
3956              CDS       T01001                                 

Gene name
LGALS1, GAL1, GBP
Definition
(RefSeq) galectin 1
  KO
K06830  
galectin-1
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   3956 (LGALS1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
     3956 (LGALS1)
 2. Integrin Family
  Beta1 integrins
   VLA-7
    ITGB1; integrin beta 1 [KO:K05719]
     3956 (LGALS1)
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     3956 (LGALS1)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  3956 (LGALS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 135 aa AA seqDB search
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtggtctggtcgccagcaacctgaatctcaaacctggagagtgccttcgagtg
cgaggcgaggtggctcctgacgctaagagcttcgtgctgaacctgggcaaagacagcaac
aacctgtgcctgcacttcaaccctcgcttcaacgcccacggcgacgccaacaccatcgtg
tgcaacagcaaggacggcggggcctgggggaccgagcagcgggaggctgtctttcccttc
cagcctggaagtgttgcagaggtgtgcatcaccttcgaccaggccaacctgaccgtcaag
ctgccagatggatacgaattcaagttccccaaccgcctcaacctggaggccatcaactac
atggcagctgacggtgacttcaagatcaaatgtgtggcctttgactga

DBGET integrated database retrieval system