KEGG   Homo sapiens (human): 396Help
Entry
396               CDS       T01001                                 

Gene name
ARHGDIA, GDIA1, HEL-S-47e, NPHS8, RHOGDI, RHOGDI-1
Definition
(RefSeq) Rho GDP dissociation inhibitor alpha
  KO
K12462  
Rho GDP-dissociation inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    396 (ARHGDIA)
  Nervous system
   04722 Neurotrophin signaling pathway
    396 (ARHGDIA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396 (ARHGDIA)
  Exosomal proteins of other body fluids (saliva and urine)
   396 (ARHGDIA)
  Exosomal proteins of colorectal cancer cells
   396 (ARHGDIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 204 aa AA seqDB search
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSR
FTDDDKTDHLSWEWNLTIKKDWKD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggagcccacagccgagcagctggcccagattgcagcggagaacgaggag
gatgagcactcggtcaactacaagcccccggcccagaagagcatccaggagatccaggag
ctggacaaggacgacgagagcctgcgaaagtacaaggaggccctgctgggccgcgtggcc
gtttccgcagaccccaacgtccccaacgtcgtggtgactggcctgaccctggtgtgcagc
tcggccccgggccccctggagctggacctgacgggcgacctggagagcttcaagaagcag
tcgtttgtgctgaaggagggtgtggagtaccggataaaaatctctttccgggttaaccga
gagatagtgtccggcatgaagtacatccagcatacgtacaggaaaggcgtcaagattgac
aagactgactacatggtaggcagctatgggccccgggccgaggagtacgagttcctgacc
cccgtggaggaggcacccaagggtatgctggcccggggcagctacagcatcaagtcccgc
ttcacagacgacgacaagaccgaccacctgtcctgggagtggaatctcaccatcaagaag
gactggaaggactga

DBGET integrated database retrieval system