KEGG   Homo sapiens (human): 396Help
Entry
396               CDS       T01001                                 

Gene name
ARHGDIA, GDIA1, HEL-S-47e, NPHS8, RHOGDI, RHOGDI-1
Definition
Rho GDP dissociation inhibitor (GDI) alpha
Orthology
K12462  
Rho GDP-dissociation inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    396 (ARHGDIA)
  Nervous system
   04722 Neurotrophin signaling pathway
    396 (ARHGDIA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396 (ARHGDIA)
  Exosomal proteins of other body fluids (saliva and urine)
   396 (ARHGDIA)
  Exosomal proteins of colorectal cancer cells
   396 (ARHGDIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 204 aa AA seqDB search
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSR
FTDDDKTDHLSWEWNLTIKKDWKD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggagcccacagccgagcagctggcccagattgcagcggagaacgaggag
gatgagcactcggtcaactacaagcccccggcccagaagagcatccaggagatccaggag
ctggacaaggacgacgagagcctgcgaaagtacaaggaggccctgctgggccgcgtggcc
gtttccgcagaccccaacgtccccaacgtcgtggtgactggcctgaccctggtgtgcagc
tcggccccgggccccctggagctggacctgacgggcgacctggagagcttcaagaagcag
tcgtttgtgctgaaggagggtgtggagtaccggataaaaatctctttccgggttaaccga
gagatagtgtccggcatgaagtacatccagcatacgtacaggaaaggcgtcaagattgac
aagactgactacatggtaggcagctatgggccccgggccgaggagtacgagttcctgacc
cccgtggaggaggcacccaagggtatgctggcccggggcagctacagcatcaagtcccgc
ttcacagacgacgacaagaccgaccacctgtcctgggagtggaatctcaccatcaagaag
gactggaaggactga

DBGET integrated database retrieval system