KEGG   Homo sapiens (human): 3973Help
Entry
3973              CDS       T01001                                 

Gene name
LHCGR, HHG, LCGR, LGR2, LH/CG-R, LH/CGR, LHR, LHRHR, LSH-R, ULG5
Definition
(RefSeq) luteinizing hormone/choriogonadotropin receptor
  KO
K04248  
luteinizing hormone/choriogonadotropin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Ovarian steroidogenesis
Prolactin signaling pathway
Disease
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
H00627  
Premature ovarian failure
H00937  
Precocious puberty
H02019  
Familial male-limited precocious puberty
Drug target
Choriogonadotropin alfa: 
Chorionic gonadotrophin: 
Human menopausal gonadotrophin (DG00472): 
Lutropin alfa: 
Serum gonadotrophin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3973 (LHCGR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3973 (LHCGR)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    3973 (LHCGR)
   04917 Prolactin signaling pathway
    3973 (LHCGR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Lutropin-choriogonadotropic hormone
    3973 (LHCGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P22888(Tclin)
UniProt: 
Position
2p16.3
AA seq 699 aa AA seqDB search
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcggttctcggcgctgcagctgctgaagctgctgctgctgctgcagccgccg
ctgccacgagcgctgcgcgaggcgctctgccctgagccctgcaactgcgtgcccgacggc
gccctgcgctgccccggccccacggccggtctcactcgactatcacttgcctacctccct
gtcaaagtgatcccatctcaagctttcagaggacttaatgaggtcataaaaattgaaatc
tctcagattgattccctggaaaggatagaagctaatgcctttgacaacctcctcaatttg
tctgaaatactgatccagaacaccaaaaatctgagatacattgagcccggagcatttata
aatcttccccgattaaaatacttgagcatctgtaacacaggcatcagaaagtttccagat
gttacgaaggtcttctcctctgaatcaaatttcattctggaaatttgtgataacttacac
ataaccaccataccaggaaatgcttttcaagggatgaataatgaatctgtaacactcaaa
ctatatggaaatggatttgaagaagtacaaagtcatgcattcaatgggacgacactgact
tcactggagctaaaggaaaacgtacatctggagaagatgcacaatggagccttccgtggg
gccacagggccgaaaaccttggatatttcttccaccaaattgcaggccctgccgagctat
ggcctagagtccattcagaggctaattgccacgtcatcctattctctaaaaaaattgcca
tcaagagaaacatttgtcaatctcctggaggccacgttgacttaccccagccactgctgt
gcttttagaaacttgccaacaaaagaacagaatttttcacattccatttctgaaaacttt
tccaaacaatgtgaaagcacagtaaggaaagtgaataacaaaacactttattcttccatg
cttgctgagagtgaactgagtggctgggactatgaatatggtttctgcttacccaagaca
ccccgatgtgctcctgaaccagatgcttttaatccctgtgaagatattatgggctatgac
ttccttagggtcctgatttggctgattaatattctagccatcatgggaaacatgactgtt
ctttttgttctcctgacaagtcgttacaaacttacagtgcctcgttttctcatgtgcaat
ctctcctttgcagacttttgcatggggctctatctgctgctcatagcctcagttgattcc
caaaccaagggccagtactataaccatgccatagactggcagacagggagtgggtgcagc
actgctggctttttcactgtattcgcaagtgaactttctgtctacaccctcaccgtcatc
actctagaaagatggcacaccatcacctatgctattcacctggaccaaaagctgcgatta
agacatgccattctgattatgcttggaggatggctcttttcttctctaattgctatgttg
ccccttgtcggtgtcagcaattacatgaaggtcagtatttgcttccccatggatgtggaa
accactctctcacaagtctatatattaaccatcctgattctcaatgtggtggccttcttc
ataatttgtgcttgctacattaaaatttattttgcagttcgaaacccagaattaatggct
accaataaagatacaaagattgctaagaaaatggcaatcctcatcttcaccgatttcacc
tgcatggcacctatctctttttttgccatctcagctgccttcaaagtacctcttatcaca
gtaaccaactctaaagttttactggttcttttttatcccatcaattcttgtgccaatcca
tttctgtatgcaatattcactaagacattccaaagagatttctttcttttgctgagcaaa
tttggctgctgtaaacgtcgggctgaactttatagaaggaaagatttttcagcttacacc
tccaactgcaaaaatggcttcactggatcaaataagccttctcaatccaccttgaagttg
tccacattgcactgtcaaggtacagctctcctagacaagactcgctacacagagtgttaa

DBGET integrated database retrieval system