KEGG   Homo sapiens (human): 3973Help
Entry
3973              CDS       T01001                                 

Gene name
LHCGR, HHG, LCGR, LGR2, LH/CG-R, LH/CGR, LHR, LHRHR, LSH-R, ULG5
Definition
luteinizing hormone/choriogonadotropin receptor
Orthology
K04248  
luteinizing hormone/choriogonadotropin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Ovarian steroidogenesis
Prolactin signaling pathway
Disease
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
H00627  
Premature ovarian failure
H00937  
Precocious puberty
Drug target
Chorionic gonadotrophin: 
Human menopausal gonadotrophin: 
Serum gonadotrophin: 
Lutropin alfa: 
Choriogonadotropin alfa: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3973 (LHCGR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3973 (LHCGR)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    3973 (LHCGR)
   04917 Prolactin signaling pathway
    3973 (LHCGR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Lutropin-choriogonadotropic hormone
    3973 (LHCGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 699 aa AA seqDB search
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcggttctcggcgctgcagctgctgaagctgctgctgctgctgcagccgccg
ctgccacgagcgctgcgcgaggcgctctgccctgagccctgcaactgcgtgcccgacggc
gccctgcgctgccccggccccacggccggtctcactcgactatcacttgcctacctccct
gtcaaagtgatcccatctcaagctttcagaggacttaatgaggtcataaaaattgaaatc
tctcagattgattccctggaaaggatagaagctaatgcctttgacaacctcctcaatttg
tctgaaatactgatccagaacaccaaaaatctgagatacattgagcccggagcatttata
aatcttccccgattaaaatacttgagcatctgtaacacaggcatcagaaagtttccagat
gttacgaaggtcttctcctctgaatcaaatttcattctggaaatttgtgataacttacac
ataaccaccataccaggaaatgcttttcaagggatgaataatgaatctgtaacactcaaa
ctatatggaaatggatttgaagaagtacaaagtcatgcattcaatgggacgacactgact
tcactggagctaaaggaaaacgtacatctggagaagatgcacaatggagccttccgtggg
gccacagggccgaaaaccttggatatttcttccaccaaattgcaggccctgccgagctat
ggcctagagtccattcagaggctaattgccacgtcatcctattctctaaaaaaattgcca
tcaagagaaacatttgtcaatctcctggaggccacgttgacttaccccagccactgctgt
gcttttagaaacttgccaacaaaagaacagaatttttcacattccatttctgaaaacttt
tccaaacaatgtgaaagcacagtaaggaaagtgaataacaaaacactttattcttccatg
cttgctgagagtgaactgagtggctgggactatgaatatggtttctgcttacccaagaca
ccccgatgtgctcctgaaccagatgcttttaatccctgtgaagatattatgggctatgac
ttccttagggtcctgatttggctgattaatattctagccatcatgggaaacatgactgtt
ctttttgttctcctgacaagtcgttacaaacttacagtgcctcgttttctcatgtgcaat
ctctcctttgcagacttttgcatggggctctatctgctgctcatagcctcagttgattcc
caaaccaagggccagtactataaccatgccatagactggcagacagggagtgggtgcagc
actgctggctttttcactgtattcgcaagtgaactttctgtctacaccctcaccgtcatc
actctagaaagatggcacaccatcacctatgctattcacctggaccaaaagctgcgatta
agacatgccattctgattatgcttggaggatggctcttttcttctctaattgctatgttg
ccccttgtcggtgtcagcaattacatgaaggtcagtatttgcttccccatggatgtggaa
accactctctcacaagtctatatattaaccatcctgattctcaatgtggtggccttcttc
ataatttgtgcttgctacattaaaatttattttgcagttcgaaacccagaattaatggct
accaataaagatacaaagattgctaagaaaatggcaatcctcatcttcaccgatttcacc
tgcatggcacctatctctttttttgccatctcagctgccttcaaagtacctcttatcaca
gtaaccaactctaaagttttactggttcttttttatcccatcaattcttgtgccaatcca
tttctgtatgcaatattcactaagacattccaaagagatttctttcttttgctgagcaaa
tttggctgctgtaaacgtcgggctgaactttatagaaggaaagatttttcagcttacacc
tccaactgcaaaaatggcttcactggatcaaataagccttctcaatccaccttgaagttg
tccacattgcactgtcaaggtacagctctcctagacaagactcgctacacagagtgttaa

DBGET integrated database retrieval system