KEGG   Homo sapiens (human): 3977Help
Entry
3977              CDS       T01001                                 

Gene name
LIFR, CD118, LIF-R, SJS2, STWS, SWS
Definition
leukemia inhibitory factor receptor alpha
Orthology
K05058  
leukemia inhibitory factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Disease
H00462  
Stuve-Wiedemann syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3977 (LIFR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3977 (LIFR)
Cellular antigens [BR:hsa04090]
 Proteins
  3977 (LIFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13-p12
AA seq 1097 aa AA seqDB search
MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNL
QVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKE
SMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSP
VKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAIK
IRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEIICSWNPGRVTA
LVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQR
NVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVIK
WCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFFLYGCRNQGYQLLRSMIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEE
DLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgatggatatttacgtatgtttgaaacgaccatcctggatggtggacaataaaagaatg
aggactgcttcaaatttccagtggctgttatcaacatttattcttctatatctaatgaat
caagtaaatagccagaaaaagggggctcctcatgatttgaagtgtgtaactaacaatttg
caagtgtggaactgttcttggaaagcaccctctggaacaggccgtggtactgattatgaa
gtttgcattgaaaacaggtcccgttcttgttatcagttggagaaaaccagtattaaaatt
ccagctctttcacatggtgattatgaaataacaataaattctctacatgattttggaagt
tctacaagtaaattcacactaaatgaacaaaacgtttccttaattccagatactccagag
atcttgaatttgtctgctgatttctcaacctctacattatacctaaagtggaacgacagg
ggttcagtttttccacaccgctcaaatgttatctgggaaattaaagttctacgtaaagag
agtatggagctcgtaaaattagtgacccacaacacaactctgaatggcaaagatacactt
catcactggagttgggcctcagatatgcccttggaatgtgccattcattttgtggaaatt
agatgctacattgacaatcttcatttttctggtctcgaagagtggagtgactggagccct
gtgaagaacatttcttggatacctgattctcagactaaggtttttcctcaagataaagtg
atacttgtaggctcagacataacattttgttgtgtgagtcaagaaaaagtgttatcagca
ctgattggccatacaaactgccccttgatccatcttgatggggaaaatgttgcaatcaag
attcgtaatatttctgtttctgcaagtagtggaacaaatgtagtttttacaaccgaagat
aacatatttggaaccgttatttttgctggatatccaccagatactcctcaacaactgaat
tgtgagacacatgatttaaaagaaattatatgtagttggaatccaggaagggtgacagcg
ttggtgggcccacgtgctacaagctacactttagttgaaagtttttcaggaaaatatgtt
agacttaaaagagctgaagcacctacaaacgaaagctatcaattattatttcaaatgctt
ccaaatcaagaaatatataattttactttgaatgctcacaatccgctgggtcgatcacaa
tcaacaattttagttaatataactgaaaaagtttatccccatactcctacttcattcaaa
gtgaaggatattaattcaacagctgttaaactttcttggcatttaccaggcaactttgca
aagattaattttttatgtgaaattgaaattaagaaatctaattcagtacaagagcagcgg
aatgtcacaatcaaaggagtagaaaattcaagttatcttgttgctctggacaagttaaat
ccatacactctatatacttttcggattcgttgttctactgaaactttctggaaatggagc
aaatggagcaataaaaaacaacatttaacaacagaagccagtccttcaaaggggcctgat
acttggagagagtggagttctgatggaaaaaatttaataatctattggaagcctttaccc
attaatgaagctaatggaaaaatactttcctacaatgtatcgtgttcatcagatgaggaa
acacagtccctttctgaaatccctgatcctcagcacaaagcagagatacgacttgataag
aatgactacatcatcagcgtagtggctaaaaattctgtgggctcatcaccaccttccaaa
atagcgagtatggaaattccaaatgatgatctcaaaatagaacaagttgttgggatggga
aaggggattctcctcacctggcattacgaccccaacatgacttgcgactacgtcattaag
tggtgtaactcgtctcggtcggaaccatgccttatggactggagaaaagttccctcaaac
agcactgaaactgtaatagaatctgatgagtttcgaccaggtataagatataattttttc
ctgtatggatgcagaaatcaaggatatcaattattacgctccatgattggatatatagaa
gaattggctcccattgttgcaccaaattttactgttgaggatacttctgcagattcgata
ttagtaaaatgggaagacattcctgtggaagaacttagaggctttttaagaggatatttg
ttttactttggaaaaggagaaagagacacatctaagatgagggttttagaatcaggtcgt
tctgacataaaagttaagaatattactgacatatcccagaagacactgagaattgctgat
cttcaaggtaaaacaagttaccacctggtcttgcgagcctatacagatggtggagtgggc
ccggagaagagtatgtatgtggtgacaaaggaaaattctgtgggattaattattgccatt
ctcatcccagtggcagtggctgtcattgttggagtggtgacaagtatcctttgctatcgg
aaacgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaa
gcattacagtttcaaaagagtgtctgtgagggaagcagtgctcttaaaacattggaaatg
aatccttgtaccccaaataatgttgaggttctggaaactcgatcagcatttcctaaaata
gaagatacagaaataatttccccagtagctgagcgtcctgaagatcgctctgatgcagag
cctgaaaaccatgtggttgtgtcctattgtccacccatcattgaggaagaaataccaaac
ccagccgcagatgaagctggagggactgcacaggttatttacattgatgttcagtcgatg
tatcagcctcaagcaaaaccagaagaagaacaagaaaatgaccctgtaggaggggcaggc
tataagccacagatgcacctccccattaattctactgtggaagatatagctgcagaagag
gacttagataaaactgcgggttacagacctcaggccaatgtaaatacatggaatttagtg
tctccagactctcctagatccatagacagcaacagtgagattgtctcatttggaagtcca
tgctccattaattcccgacaatttttgattcctcctaaagatgaagactctcctaaatct
aatggaggagggtggtcctttacaaacttttttcagaacaaaccaaacgattaa

DBGET integrated database retrieval system