KEGG   Homo sapiens (human): 3983Help
Entry
3983              CDS       T01001                                 

Gene name
ABLIM1, ABLIM, LIMAB1, LIMATIN, abLIM-1
Definition
(RefSeq) actin binding LIM protein 1
  KO
K07520  
actin-binding LIM protein
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    3983 (ABLIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25
AA seq 778 aa AA seqDB search
MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFTAHRRATITHL
LYLCPKDYCPRGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHI
KCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPN
CFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALL
ALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAG
DKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRP
GSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQER
QSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRP
GNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKS
SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRR
QLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYG
RNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEM
LMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttccttggtctaaagtgtctggggaaattgtgcagctctgagaaaagcaaa
gtcacctcatctgagagaaccagtgccaggggctcgaacagaaagagactgattgttgag
gaccggagggtctctgggacctccttcaccgctcataggcgtgccactatcactcatttg
ctgtatctctgtcccaaggactactgcccacgtgggcgtgtatgtaacagcgttgatcct
tttgtggcccaccctcaggaccctcaccacccatcagagaagcctgtcattcactgccat
aaatgtggggagccttgcaagggtgaagtgcttcgggtccagaccaaacatttccacatc
aagtgtttcacctgcaaagtgtgtggctgtgacctggcacaagggggcttcttcataaag
aacggagagtatctctgcaccctggactaccagcggatgtacgggacacgctgccatggc
tgtggggagttcgtggagggcgaagtggtgactgctctgggcaagacctaccatcccaat
tgctttgcttgtactatctgcaagcgcccgtttccacccggagaccgagtcacattcaat
gggagagactgcctttgtcaactctgtgcacagccgatgtcgtccagtccgaaagaaacc
accttctccagcaattgtgccggctgcggaagagatatcaagaatgggcaggcgctgctg
gcgctggataagcagtggcacttggggtgctttaaatgcaagtcctgcgggaaggtcctc
accggggagtacatcagcaaggatggtgctccgtactgtgaaaaggactaccagggactc
tttggggtgaaatgtgaggcgtgtcaccagtttatcacagggaaagtcctggaggcaggt
gacaaacattaccaccccagctgtgcacgatgcagcagatgcaaccagatgttcacagaa
ggagaggaaatgtatcttcaaggctccaccgtttggcatcccgactgtaagcaatctacg
aagaccgaggaaaagctgcggcctaccaggacatcctcggaaagtatttattctaggcca
ggctccagtattcctggctcaccaggtcatactatctatgcaaaagtagacaatgagatc
ctggattacaaggatttagcagccattccgaaggtcaaggcaatttatgacattgaacgt
ccagatcttattacctatgagcctttctacacttcgggctatgatgacaaacaggagaga
cagagccttggagagtctccgaggactttgtctcctactccatcagcagaagggtaccag
gatgttcgggatcggatgatccatcggtccacgagccagggctccatcaactcccctgtg
tacagccgccacagctacactccaaccacgtcccgctctccccagcatttccacagacct
ggcaatgagccgtccagcggccggaactcccctctcccttaccggccagacagccgccct
ctaactccaacttacgctcaggcccctaaacatttccatgttccagatcaaggaatcaac
atttaccgaaagccacccatctacaaacagcatgctgccttggcagcccagagcaagtcc
tcagaagatatcatcaagttttccaagttcccagcagcccaggcaccagaccccagcgag
acaccaaagattgagacggaccactggcctggtcccccctcatttgctgtcgtaggacct
gacatgaaacgcagatctagtggcagagaggaagatgatgaggaacttctgagacgtcgg
cagcttcaagaagagcaattaatgaagcttaactcaggcctgggacagttgatcttgaaa
gaagagatggagaaagagagccgggaaaggtcatctctgttagccagtcgctacgattct
cccatcaactcagcttcacatattccatcatctaaaactgcatctctccctggctatgga
agaaatgggcttcaccggcctgtttctaccgacttcgctcagtataacagctatggggat
gtcagcgggggagtgcgagattaccagacactcccagatggccacatgcctgcaatgaga
atggaccgaggagtgtctatgcccaacatgttggaaccaaagatatttccatatgaaatg
ctcatggtgaccaacagagggcgaaacaaaatcctcagagaggtggacagaaccaggctg
gagcgccacttagcccctgaagtgtttcgggaaatctttggaatgtccatacaggagttt
gacaggttacctctttggagacgcaacgacatgaagaaaaaagcaaaactcttctaa

DBGET integrated database retrieval system