KEGG   Homo sapiens (human): 3984Help
Entry
3984              CDS       T01001                                 

Gene name
LIMK1, LIMK, LIMK-1
Definition
LIM domain kinase 1 (EC:2.7.11.1)
Orthology
K05743  
LIM domain kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3984 (LIMK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    3984 (LIMK1)
  Development
   04360 Axon guidance
    3984 (LIMK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3984 (LIMK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   3984 (LIMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 613 aa AA seqDB search
MLLASAPRRRRFLQRAKCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKG
LVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDS
PGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVK
NSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLS
SPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIF
RPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHP
NVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSM
NIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPY
WMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPN
CPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR
GESGLPAHPEVPD
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggcttcagccccaagaagacgccgcttcctccagagggctaagtgttgtgac
tgcagtgcctccctgtcgcaccagtactatgagaaggatgggcagctcttctgcaagaag
gactactgggcccgctatggcgagtcctgccatgggtgctctgagcaaatcaccaaggga
ctggttatggtggctggggagctgaagtaccaccccgagtgtttcatctgcctcacgtgt
gggacctttatcggtgacggggacacctacacgctggtggagcactccaagctgtactgc
gggcactgctactaccagactgtggtgacccccgtcatcgagcagatcctgcctgactcc
cctggctcccacctgccccacaccgtcaccctggtgtccatcccagcctcatctcatggc
aagcgtggactttcagtctccattgaccccccgcacggcccaccgggctgtggcaccgag
cactcacacaccgtccgcgtccagggagtggatccgggctgcatgagcccagatgtgaag
aattccatccacgtcggagaccggatcttggaaatcaatggcacgcccatccgaaatgtg
cccctggacgagattgacctgctgattcaggaaaccagccgcctgctccagctgaccctc
gagcatgaccctcacgatacactgggccacgggctggggcctgagaccagccccctgagc
tctccggcttatactcccagcggggaggcgggcagctctgcccggcagaaacctgtcttg
aggagctgcagcatcgacaggtctccgggcgctggctcactgggctccccggcctcccag
cgcaaggacctgggtcgctctgagtccctccgcgtagtctgccggccacaccgcatcttc
cggccgtcggacctcatccacggggaggtgctgggcaagggctgcttcggccaggctatc
aaggtgacacaccgtgagacaggtgaggtgatggtgatgaaggagctgatccggttcgac
gaggagacccagaggacgttcctcaaggaggtgaaggtcatgcgatgcctggaacacccc
aacgtgctcaagttcatcggggtgctctacaaggacaagaggctcaacttcatcactgag
tacatcaagggcggcacgctccggggcatcatcaagagcatggacagccagtacccatgg
agccagagagtgagctttgccaaggacatcgcatcagggatggcctacctccactccatg
aacatcatccaccgagacctcaactcccacaactgcctggtccgcgagaacaagaatgtg
gtggtggctgacttcgggctggcgcgtctcatggtggacgagaagactcagcctgagggc
ctgcggagcctcaagaagccagaccgcaagaagcgctacaccgtggtgggcaacccctac
tggatggcacctgagatgatcaacggccgcagctatgatgagaaggtggatgtgttctcc
tttgggatcgtcctgtgcgagatcatcgggcgggtgaacgcagaccctgactacctgccc
cgcaccatggactttggcctcaacgtgcgaggattcctggaccgctactgccccccaaac
tgccccccgagcttcttccccatcaccgtgcgctgttgcgatctggaccccgagaagagg
ccatcctttgtgaagctggaacactggctggagaccctccgcatgcacctggccggccac
ctgccactgggcccacagctggagcagctggacagaggtttctgggagacctaccggcgc
ggcgagagcggactgcctgcccaccctgaggtccccgactga

DBGET integrated database retrieval system