KEGG   Homo sapiens (human): 3984Help
Entry
3984              CDS       T01001                                 

Gene name
LIMK1, LIMK, LIMK-1
Definition
LIM domain kinase 1 (EC:2.7.11.1)
Orthology
K05743  
LIM domain kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 613 aa AA seqDB search
MLLASAPRRRRFLQRAKCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKG
LVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDS
PGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVK
NSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLS
SPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIF
RPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHP
NVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSM
NIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPY
WMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPN
CPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR
GESGLPAHPEVPD
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggcttcagccccaagaagacgccgcttcctccagagggctaagtgttgtgac
tgcagtgcctccctgtcgcaccagtactatgagaaggatgggcagctcttctgcaagaag
gactactgggcccgctatggcgagtcctgccatgggtgctctgagcaaatcaccaaggga
ctggttatggtggctggggagctgaagtaccaccccgagtgtttcatctgcctcacgtgt
gggacctttatcggtgacggggacacctacacgctggtggagcactccaagctgtactgc
gggcactgctactaccagactgtggtgacccccgtcatcgagcagatcctgcctgactcc
cctggctcccacctgccccacaccgtcaccctggtgtccatcccagcctcatctcatggc
aagcgtggactttcagtctccattgaccccccgcacggcccaccgggctgtggcaccgag
cactcacacaccgtccgcgtccagggagtggatccgggctgcatgagcccagatgtgaag
aattccatccacgtcggagaccggatcttggaaatcaatggcacgcccatccgaaatgtg
cccctggacgagattgacctgctgattcaggaaaccagccgcctgctccagctgaccctc
gagcatgaccctcacgatacactgggccacgggctggggcctgagaccagccccctgagc
tctccggcttatactcccagcggggaggcgggcagctctgcccggcagaaacctgtcttg
aggagctgcagcatcgacaggtctccgggcgctggctcactgggctccccggcctcccag
cgcaaggacctgggtcgctctgagtccctccgcgtagtctgccggccacaccgcatcttc
cggccgtcggacctcatccacggggaggtgctgggcaagggctgcttcggccaggctatc
aaggtgacacaccgtgagacaggtgaggtgatggtgatgaaggagctgatccggttcgac
gaggagacccagaggacgttcctcaaggaggtgaaggtcatgcgatgcctggaacacccc
aacgtgctcaagttcatcggggtgctctacaaggacaagaggctcaacttcatcactgag
tacatcaagggcggcacgctccggggcatcatcaagagcatggacagccagtacccatgg
agccagagagtgagctttgccaaggacatcgcatcagggatggcctacctccactccatg
aacatcatccaccgagacctcaactcccacaactgcctggtccgcgagaacaagaatgtg
gtggtggctgacttcgggctggcgcgtctcatggtggacgagaagactcagcctgagggc
ctgcggagcctcaagaagccagaccgcaagaagcgctacaccgtggtgggcaacccctac
tggatggcacctgagatgatcaacggccgcagctatgatgagaaggtggatgtgttctcc
tttgggatcgtcctgtgcgagatcatcgggcgggtgaacgcagaccctgactacctgccc
cgcaccatggactttggcctcaacgtgcgaggattcctggaccgctactgccccccaaac
tgccccccgagcttcttccccatcaccgtgcgctgttgcgatctggaccccgagaagagg
ccatcctttgtgaagctggaacactggctggagaccctccgcatgcacctggccggccac
ctgccactgggcccacagctggagcagctggacagaggtttctgggagacctaccggcgc
ggcgagagcggactgcctgcccaccctgaggtccccgactga

DBGET integrated database retrieval system