KEGG   Homo sapiens (human): 399Help
Entry
399               CDS       T01001                                 

Gene name
RHOH, ARHH, TTF
Definition
ras homolog family member H
Orthology
K07873  
Ras homolog gene family, member H
Organism
hsa  Homo sapiens (human)
Pathway
Leukocyte transendothelial migration
Class
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4p13
AA seq 191 aa AA seqDB search
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ
REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
RLFSINECKIF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgctgagttccatcaagtgcgtgttggtgggcgactctgctgtggggaaaacctctctg
ttggtgcgcttcacctccgagaccttcccggaggcctacaagcccacagtgtacgagaac
acaggggtggacgtcttcatggatggcatccagatcagcctgggcctctgggacacagcc
ggcaatgacgccttcagaagcatccggcccctgtcctaccagcaggcagacgtggtgctg
atgtgctactctgtggccaaccataactcattcctgaacttgaagaacaagtggattggt
gaaattaggagcaacttgccctgtacccctgtgctggtggtggccacccagactgaccag
cgggagatggggccccacagggcctcctgcgtcaatgccatggaagggaagaaactggcc
caggatgtcagagccaagggctacctggagtgctcagcccttagcaatcggggagtacag
caggtgtttgagtgcgccgtccgaactgccgtcaaccaggccaggagacgaaacagaagg
aggctcttctccatcaatgagtgcaagatcttctaa

DBGET integrated database retrieval system