KEGG   Homo sapiens (human): 3990Help
Entry
3990              CDS       T01001                                 

Gene name
LIPC, HDLCQ12, HL, HTGL, LIPH
Definition
lipase, hepatic (EC:3.1.1.3)
Orthology
K01046  
triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21-q23
AA seq 499 aa AA seqDB search
MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQ
GCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLV
DWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSS
IGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGH
YDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQFKIQF
INQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW
ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQ
EKIFVKCEIKSKTSKRKIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggacacaagtcccctgtgtttctccattctgttggttttatgcatctttatccaatca
agtgcccttggacaaagcctgaaaccagagccatttggaagaagagctcaagctgttgaa
acaaacaaaacgctgcatgagatgaagaccagattcctgctctttggagaaaccaatcag
ggctgtcagattcgaatcaatcatccggacacgttacaggagtgcggcttcaactcctcc
ctgcctctggtgatgataatccacgggtggtcggtggacggcgtgctagaaaactggatc
tggcagatggtggccgcgctgaagtctcagccggcccagccagtgaacgtggggctggtg
gactggatcaccctggcccacgaccactacaccatcgccgtccgcaacacccgccttgtg
ggcaaggaggtcgcggctcttctccggtggctggaggaatctgtgcaactctctcgaagc
catgttcacctaattgggtacagcctgggtgcacacgtgtcaggatttgccggcagttcc
atcggtggaacgcacaagattgggagaatcacagggctggatgccgcgggacctttgttt
gagggaagtgcccccagcaatcgtctttctccagatgatgccaattttgtggatgccatt
catacctttacccgggagcacatgggcctgagcgtgggcatcaaacagcccataggacac
tatgacttctatcccaacgggggctccttccagcctggctgccacttcctagagctctac
agacatattgcccagcacggcttcaatgccatcacccagaccataaaatgctcccacgag
cgatcggtgcaccttttcatcgactccttgctgcacgccggcacgcagagcatggcctac
ccgtgtggtgacatgaacagcttcagccagggcctgtgcctgagctgcaagaagggccgc
tgcaacacgctgggctaccacgtccgccaggagccgcggagcaagagcaagaggctcttc
ctcgtaacgcgagcccagtcccccttcaaagtttatcattaccagttcaagatccagttc
atcaaccaaactgagacaccaatacaaacaacttttaccatgtcactactcggaacaaaa
gagaaaatgcagaaaattcccatcactctgggcaaaggaattgctagtaataaaacgtat
tcctttcttatcacgctggatgtggatatcggcgagctgatcatgatcaagttcaagtgg
gaaaacagtgcagtgtgggccaatgtctgggacacggtccagaccatcatcccatggagc
acagggccgcgccactcaggcctcgttctgaagacgatcagagtcaaagcaggagaaacc
cagcaaagaatgacattttgttcagaaaacacagatgacctactacttcgcccaacccag
gaaaaaatcttcgtgaaatgtgaaataaagtctaaaacatcaaagcgaaagatcagatga

DBGET integrated database retrieval system