KEGG   Homo sapiens (human): 3991Help
Entry
3991              CDS       T01001                                 

Gene name
LIPE, HSL, LHS
Definition
lipase, hormone-sensitive (EC:3.1.1.79)
Orthology
K07188  
hormone-sensitive lipase [EC:3.1.1.79]
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    3991 (LIPE)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3991 (LIPE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     3991 (LIPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 1076 aa AA seqDB search
MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQ
QETPAQHDAESQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLG
KESITQQEPALRQRHVAQPGPGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQET
PEQSDKQTTPVQGAKSKQGSLTELGFLTKLQELSIQRSALEWKALSEWVTDSESESDVGS
SSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPHEKTSARNHRHYQDTASRLIH
NMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEPALGRLLGVAH
LFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRP
FLQTISIGLVSFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWK
AFWNITEMEVLSSLANMASATVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGP
VLVRLISYDLREGQDSEELSSLIKSNGQRSLELWPRPQQAPRSRSLIVHFHGGGFVAQTS
RSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFFAYCWAIKHCALLGSTGERIC
LAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVL
SKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAET
LSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLY
SSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVE
DLPHGFLTLAALCRETRQAAELCVERIRLVLTPPAGAGPSGETGAAGVDGGCGGRH
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggagccaggttctaagtcagtgtctaggtcagactggcaacctgaaccacaccagagg
cctataaccccgctagagcctgggccagaaaagacacccatagcccagccagaatcgaag
actctgcagggatccaatacccaacagaagcctgcttcaaaccaaagacccctcacccag
caggagacccctgcacaacatgatgctgaatcccagaaggaacctagagcccaacaaaaa
tctgcttcacaagaggaatttcttgccccacagaagcccgcaccacagcaatcaccttac
atccaaagggtgctgctcactcaacaggaagctgcctcccagcagggacctgggctagga
aaagaatctataactcaacaggagccagcattgagacaaagacatgtagcccagccaggg
cctgggccaggagagccacctccagctcaacaagaagctgaatcaacacctgcggcccag
gctaaacctggagccaaaagggagccatctgccccgactgaatctacgtcccaagagaca
cctgaacagtcagacaagcaaacaacgccagtccagggagccaaatccaagcagggatct
ttgacagagctgggatttctaacaaaacttcaggaactatccatacagcgatcagcccta
gagtggaaggcactttctgagtgggtcacagattctgagtcagaatcagatgtgggatca
tcttcagacacagattctccagccacgatgggtggaatggtggcccagggagtgaagcta
ggcttcaaaggaaaatctggttataaagtgatgtcaggatacagtgggacgtcgccacat
gagaaaaccagtgctcggaatcacagacactaccaggatacagcctcaaggctcatccac
aacatggacctgcgcacaatgacacagtcgctggtgactctggcggaggacaacatagcc
ttcttctcgagccagggtcctggggaaacggcccagcggctgtcaggcgtttttgccggt
gtacgggagcaggcgctggggctggagccggccctgggccgcctgctgggtgtggcgcac
ctctttgacctggacccagagacaccggccaacgggtaccgcagcctagtgcacacagcc
cgctgctgcctggcgcacctcctgcacaaatcccgctatgtggcctccaaccgccgcagc
atcttcttccgcaccagccacaacctggccgagctggaggcctacctggctgccctcacc
cagctccgcgctctggtctactacgcccagcgcctgctggttaccaatcggccgggggta
ctcttctttgagggcgacgaggggctcaccgccgacttcctccgggagtatgtcacgctg
cataagggatgcttctatggccgctgcctgggcttccagttcacgcctgccatccggcca
ttcctgcagaccatctccattgggctggtgtccttcggggagcactacaaacgcaacgag
acaggcctcagtgtggccgccagctctctcttcaccagcggccgctttgccatcgacccc
gagctgcgtggggctgagtttgagcggatcacacagaacctggacgtgcacttctggaaa
gccttctggaacatcaccgagatggaagtgctatcgtctctggccaacatggcatcggcc
accgtgagggtaagccgcctgctcagcctgccacccgaagcctttgagatgccactgact
gccgaccccacgctcacggtcaccatctcacccccactggcccacacaggccctgggccc
gtcctcgtcaggctcatctcctatgacctgcgtgaaggacaggacagtgaggagctcagc
agcctgataaagtccaacggccaacggagcctggagctgtggccgcgcccccagcaggca
ccccgctcgcggtccctgatagtgcacttccacggcggtggctttgtggcccagacctcc
agatcccacgagccctacctcaagagctgggcccaggagctgggcgcccccatcatctcc
atcgactactccctggcccctgaggcccccttcccccgtgcgctggaggagtgcttcttc
gcctactgctgggccatcaagcactgcgccctccttggctcaacaggggaacgaatctgc
cttgcgggggacagtgcaggcgggaacctctgcttcaccgtggctcttcgggcagcagcc
tacggggtgcgggtgccagatggcatcatggcagcctacccggccacaatgctgcagcct
gccgcctctccctcccgcctgctgagcctcatggaccccttgctgcccctcagtgtgctc
tccaagtgtgtcagcgcctatgctggtgcaaagacggaggaccactccaactcagaccag
aaagccctcggcatgatggggctggtgcggcgggacacagccctgctcctccgagacttc
cgcctgggtgcctcctcatggctcaactccttcctggagttaagtgggcgcaagtcccag
aagatgtcggagcccatagcagagccgatgcgccgcagtgtgtctgaagcagcactggcc
cagccccagggcccactgggcacggattccctcaagaacctgaccctgagggacttgagc
ctgaggggaaactccgagacgtcgtcggacacccccgagatgtcgctgtcagctgagaca
cttagcccctccacaccctccgatgtcaacttcttattaccacctgaggatgcaggggaa
gaggctgaggccaaaaatgagctgagccccatggacagaggcctgggcgtccgtgccgcc
ttccccgagggtttccacccccgacgctccagccagggtgccacacagatgcccctctac
tcctcacccatagtcaagaaccccttcatgtcgccgctgctggcacccgacagcatgctc
aagagcctgccacctgtgcacatcgtggcgtgcgcgctggaccccatgctggacgactcg
gtcatgctcgcgcggcgactgcgcaacctgggccagccggtgacgctgcgcgtggtggag
gacctgccgcacggcttcctgaccctagcggcgctgtgccgcgagacgcgccaggccgca
gagctgtgcgtggagcgcatccgcctcgtcctcactcctcccgccggagccgggccgagc
ggggagacgggggctgcgggggtagacgggggctgcggggggcgacactaa

DBGET integrated database retrieval system