KEGG   Homo sapiens (human): 3991Help
Entry
3991              CDS       T01001                                 

Gene name
LIPE, AOMS4, FPLD6, HSL, LHS
Definition
(RefSeq) lipase E, hormone sensitive type (EC:3.1.1.79)
  KO
K07188  
hormone-sensitive lipase [EC:3.1.1.79]
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Regulation of lipolysis in adipocytes
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    3991 (LIPE)
   04152 AMPK signaling pathway
    3991 (LIPE)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3991 (LIPE)
   04923 Regulation of lipolysis in adipocyte
    3991 (LIPE)
   04925 Aldosterone synthesis and secretion
    3991 (LIPE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     3991 (LIPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 1076 aa AA seqDB search
MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQ
QETPAQHDAESQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLG
KESITQQEPALRQRHVAQPGPGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQET
PEQSDKQTTPVQGAKSKQGSLTELGFLTKLQELSIQRSALEWKALSEWVTDSESESDVGS
SSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPHEKTSARNHRHYQDTASRLIH
NMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEPALGRLLGVAH
LFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRP
FLQTISIGLVSFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWK
AFWNITEMEVLSSLANMASATVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGP
VLVRLISYDLREGQDSEELSSLIKSNGQRSLELWPRPQQAPRSRSLIVHFHGGGFVAQTS
RSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFFAYCWAIKHCALLGSTGERIC
LAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVL
SKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAET
LSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLY
SSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVE
DLPHGFLTLAALCRETRQAAELCVERIRLVLTPPAGAGPSGETGAAGVDGGCGGRH
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggagccaggttctaagtcagtgtctaggtcagactggcaacctgaaccacaccagagg
cctataaccccgctagagcctgggccagaaaagacacccatagcccagccagaatcgaag
actctgcagggatccaatacccaacagaagcctgcttcaaaccaaagacccctcacccag
caggagacccctgcacaacatgatgctgaatcccagaaggaacctagagcccaacaaaaa
tctgcttcacaagaggaatttcttgccccacagaagcccgcaccacagcaatcaccttac
atccaaagggtgctgctcactcaacaggaagctgcctcccagcagggacctgggctagga
aaagaatctataactcaacaggagccagcattgagacaaagacatgtagcccagccaggg
cctgggccaggagagccacctccagctcaacaagaagctgaatcaacacctgcggcccag
gctaaacctggagccaaaagggagccatctgccccgactgaatctacgtcccaagagaca
cctgaacagtcagacaagcaaacaacgccagtccagggagccaaatccaagcagggatct
ttgacagagctgggatttctaacaaaacttcaggaactatccatacagcgatcagcccta
gagtggaaggcactttctgagtgggtcacagattctgagtcagaatcagatgtgggatca
tcttcagacacagattctccagccacgatgggtggaatggtggcccagggagtgaagcta
ggcttcaaaggaaaatctggttataaagtgatgtcaggatacagtgggacgtcgccacat
gagaaaaccagtgctcggaatcacagacactaccaggatacagcctcaaggctcatccac
aacatggacctgcgcacaatgacacagtcgctggtgactctggcggaggacaacatagcc
ttcttctcgagccagggtcctggggaaacggcccagcggctgtcaggcgtttttgccggt
gtacgggagcaggcgctggggctggagccggccctgggccgcctgctgggtgtggcgcac
ctctttgacctggacccagagacaccggccaacgggtaccgcagcctagtgcacacagcc
cgctgctgcctggcgcacctcctgcacaaatcccgctatgtggcctccaaccgccgcagc
atcttcttccgcaccagccacaacctggccgagctggaggcctacctggctgccctcacc
cagctccgcgctctggtctactacgcccagcgcctgctggttaccaatcggccgggggta
ctcttctttgagggcgacgaggggctcaccgccgacttcctccgggagtatgtcacgctg
cataagggatgcttctatggccgctgcctgggcttccagttcacgcctgccatccggcca
ttcctgcagaccatctccattgggctggtgtccttcggggagcactacaaacgcaacgag
acaggcctcagtgtggccgccagctctctcttcaccagcggccgctttgccatcgacccc
gagctgcgtggggctgagtttgagcggatcacacagaacctggacgtgcacttctggaaa
gccttctggaacatcaccgagatggaagtgctatcgtctctggccaacatggcatcggcc
accgtgagggtaagccgcctgctcagcctgccacccgaagcctttgagatgccactgact
gccgaccccacgctcacggtcaccatctcacccccactggcccacacaggccctgggccc
gtcctcgtcaggctcatctcctatgacctgcgtgaaggacaggacagtgaggagctcagc
agcctgataaagtccaacggccaacggagcctggagctgtggccgcgcccccagcaggca
ccccgctcgcggtccctgatagtgcacttccacggcggtggctttgtggcccagacctcc
agatcccacgagccctacctcaagagctgggcccaggagctgggcgcccccatcatctcc
atcgactactccctggcccctgaggcccccttcccccgtgcgctggaggagtgcttcttc
gcctactgctgggccatcaagcactgcgccctccttggctcaacaggggaacgaatctgc
cttgcgggggacagtgcaggcgggaacctctgcttcaccgtggctcttcgggcagcagcc
tacggggtgcgggtgccagatggcatcatggcagcctacccggccacaatgctgcagcct
gccgcctctccctcccgcctgctgagcctcatggaccccttgctgcccctcagtgtgctc
tccaagtgtgtcagcgcctatgctggtgcaaagacggaggaccactccaactcagaccag
aaagccctcggcatgatggggctggtgcggcgggacacagccctgctcctccgagacttc
cgcctgggtgcctcctcatggctcaactccttcctggagttaagtgggcgcaagtcccag
aagatgtcggagcccatagcagagccgatgcgccgcagtgtgtctgaagcagcactggcc
cagccccagggcccactgggcacggattccctcaagaacctgaccctgagggacttgagc
ctgaggggaaactccgagacgtcgtcggacacccccgagatgtcgctgtcagctgagaca
cttagcccctccacaccctccgatgtcaacttcttattaccacctgaggatgcaggggaa
gaggctgaggccaaaaatgagctgagccccatggacagaggcctgggcgtccgtgccgcc
ttccccgagggtttccacccccgacgctccagccagggtgccacacagatgcccctctac
tcctcacccatagtcaagaaccccttcatgtcgccgctgctggcacccgacagcatgctc
aagagcctgccacctgtgcacatcgtggcgtgcgcgctggaccccatgctggacgactcg
gtcatgctcgcgcggcgactgcgcaacctgggccagccggtgacgctgcgcgtggtggag
gacctgccgcacggcttcctgaccctagcggcgctgtgccgcgagacgcgccaggccgca
gagctgtgcgtggagcgcatccgcctcgtcctcactcctcccgccggagccgggccgagc
ggggagacgggggctgcgggggtagacgggggctgcggggggcgacactaa

DBGET integrated database retrieval system