KEGG   Homo sapiens (human): 3992Help
Entry
3992              CDS       T01001                                 

Gene name
FADS1, D5D, FADS6, FADSD5, LLCDL1, TU12
Definition
fatty acid desaturase 1 (EC:1.14.19.-)
Orthology
K10224  
fatty acid desaturase 1 (delta-5 desaturase) [EC:1.14.19.-]
Organism
hsa  Homo sapiens (human)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    3992 (FADS1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    3992 (FADS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.-  
     3992 (FADS1)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Front-end
   3992 (FADS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.2-q13.1
AA seq 501 aa AA seqDB search
MGTRAARPAGLPCGAENPARRRLALGARQQIHSWSPRTPSTRLTAPAGPARGVARPAMAP
DPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYA
GQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMG
LMKANHVFFLLYLLHILLLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGH
LSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFALGK
ILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVIQRKKWVDLAWMITFY
VRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQAT
CNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAF
ADIIHSLKESGQLWLDAYLHQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgcgcgctgcgaggcccgccggtctgccctgcggtgctgaaaacccggcgcgc
aggcggctggctctgggcgcgcgccagcaaatccactcctggagcccgcggaccccgagc
acgcgcctgacagcccctgctggcccggcgcgcggcgtcgccaggccagctatggccccc
gacccggtggccgccgagaccgcggctcagggacctaccccgcgctacttcacctgggac
gaggtggcccagcgctcagggtgcgaggagcggtggctagtgatcgaccgtaaggtgtac
aacatcagcgagttcacccgccggcatccagggggctcccgggtcatcagccactacgcc
gggcaggatgccacggatccctttgtggccttccacatcaacaagggccttgtgaagaag
tatatgaactctctcctgattggagaactgtctccagagcagcccagctttgagcccacc
aagaataaagagctgacagatgagttccgggagctgcgggccacagtggagcggatgggg
ctcatgaaggccaaccatgtcttcttcctgctgtacctgctgcacatcttgctgctggat
ggtgcagcctggctcaccctttgggtctttgggacgtcctttttgcccttcctcctctgt
gcggtgctgctcagtgcagttcaggcccaggctggctggctgcagcatgactttgggcac
ctgtcggtcttcagcacctcaaagtggaaccatctgctacatcattttgtgattggccac
ctgaagggggcccccgccagttggtggaaccacatgcacttccagcaccatgccaagccc
aactgcttccgcaaagacccagacatcaacatgcatcccttcttctttgccttggggaag
atcctctctgtggagcttgggaaacagaagaaaaaatatatgccgtacaaccaccagcac
aaatacttcttcctaattgggcccccagccttgctgcctctctacttccagtggtatatt
ttctattttgttatccagcgaaagaagtgggtggacttggcctggatgattaccttctac
gtccgcttcttcctcacttatgtgccactattggggctgaaagccttcctgggccttttc
ttcatagtcaggttcctggaaagcaactggtttgtgtgggtgacacagatgaaccatatt
cccatgcacattgatcatgaccggaacatggactgggtttccacccagctccaggccaca
tgcaatgtccacaagtctgccttcaatgactggttcagtggacacctcaacttccagatt
gagcaccatctttttcccacgatgcctcgacacaattaccacaaagtggctcccctggtg
cagtccttgtgtgccaagcatggcatagagtaccagtccaagcccctgctgtcagccttc
gccgacatcatccactcactaaaggagtcagggcagctctggctagatgcctatcttcac
caataa

DBGET integrated database retrieval system