KEGG   Homo sapiens (human): 3993Help
Entry
3993              CDS       T01001                                 

Gene name
LLGL2, HGL, Hugl-2, LGL2
Definition
(RefSeq) LLGL2, scribble cell polarity complex component
  KO
K06094  
lethal(2) giant larvae protein
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    3993 (LLGL2)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    3993 (LLGL2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    3993 (LLGL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6P1M3(Tbio)
UniProt: 
Position
17q25.1
AA seq 1020 aa AA seqDB search
MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYG
APGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLR
GPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQR
DGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIF
QGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEE
LVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEW
PIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFS
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQ
AVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFAD
TYLKDSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGIL
VLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEG
SRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIAS
CVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARN
SGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggttcctgaggccagggcatgaccctgtgcgggagaggctcaagcgggacctg
ttccagtttaacaagacggtggagcatggcttcccgcaccagcccagcgccctcggctac
agcccgtccctgcgcatcctggccatcggcacccgttctggagccatcaagctctacgga
gccccaggcgtggagttcatggggctgcaccaggagaacaacgctgtgacgcagatccac
ctcctgcccggccagtgccagctggtcaccctgctggatgacaacagcctgcacctttgg
agcctgaaggtcaagggcggggcatcggagctgcaggaggatgagagcttcacactgcgt
ggacccccaggggctgcccccagtgccacacagatcaccgtggtcctgccacattcctcc
tgcgagctgctctacctgggcaccgagagtggcaacgtgtttgtggtgcagctgccagct
tttcgtgcgctggaggaccggaccatcagctcggacgcggtgctgcagcggttgccagag
gaggcccgccaccggcgtgtgttcgagatggtggaggcactgcaggagcaccctcgagac
cccaaccagatcctgatcggctacagccgaggcctcgttgtcatctgggacctacagggc
agccgcgtgctctaccacttcctcagcagccagcaactggagaacatctggtggcagcgg
gacggccgcctgctcgtcagctgtcactctgacggcagctactgccagtggcccgtgtcc
agcgaagcccagcaaccagagcccctccgcagcctcgtgccttacggtccctttccttgc
aaagcgattaccagaatcctctggctgaccactaggcaggggttgcccttcaccatcttc
cagggtggcatgccacgggccagctacggggaccgccactgcatctcagtgatccacgat
ggccagcagacggccttcgacttcacctcccgtgtcatcggcttcactgtcctcacagag
gcagaccctgcagccacctttgacgacccctatgccctggtggtgctggctgaggaggag
ctggtggtgattgacctgcagacagcaggctggccaccggtccagctgccctacctggct
tctctgcactgttccgccatcacctgctctcaccacgtctccaacatcccgctgaagctg
tgggagcggatcattgccgccggcagccggcagaacgcacacttctccaccatggagtgg
ccaattgatggtggcaccagcctgaccccagccccaccccagagggacctgctgctcaca
gggcacgaggacggcacggtgcggttctgggatgcctcgggtgtctgcctgcggctgctc
tacaaactcagcactgtgcgcgtgttcctcaccgacacggaccccaacgagaacttcagt
gcccagggcgaggacgagtggcccccactccgcaaggtgggctcctttgacccctacagt
gatgacccccggctgggcatccagaagatcttcctctgcaagtacagcggctacctggct
gtggcaggcacggcagggcaggtgctggtactggaactgaatgacgaggcagcggagcag
gctgtggagcaggtggaggccgacctgctgcaggaccaagagggctaccgctggaagggg
cacgagcgcctggcagcccgctcagggcccgtgcgctttgagcctggctttcagcccttc
gtgttggtgcagtgtcagcccccggctgtggtcacctccttggccctgcactctgagtgg
cggctcgtggccttcggcaccagccatggctttggcctctttgaccaccagcagcggcgg
caggtctttgttaagtgcacactgcaccccagtgaccagctggccttggagggcccactc
tcccgcgtcaagtccctcaagaagtccttgcgtcagtcattccgccggatgcgtcggagc
cgggtgtccagccggaagcggcacccggctggccccccaggagaggcacaggaggggagt
gccaaggctgagcggccaggcctccagaacatggagctggcgcctgtgcagcgcaagatc
gaggctcgctcggcagaggactccttcacaggcttcgtccggaccctgtactttgctgac
acctacctgaaggacagctcccggcactgcccctcgctgtgggctggcaccaatgggggc
accatctatgccttctccctgcgtgtgcctcccgccgagcggagaatggatgagcctgtg
cgggcagagcaggccaaggagatccagctgatgcaccgggcgccggtggtgggcatcctg
gtgctcgacggacacagcgtaccccttcccgagcccctcgaagtggcccatgatctgtcg
aagagccctgacatgcagggaagccaccagctgctcgtcgtatcagaggagcagttcaag
gtgttcacgctgcccaaggtgagtgccaagctgaagttgaagctgacggccctggagggc
tcaagagtgcggcgggtcagcgtggcccacttcggcagtcgtcgagccgaggactacggg
gagcaccacctggcagtccttaccaacctgggcgacatccaggtggtctcgctgcccctg
ctcaagccccaggtgcgctacagctgcatccgccgggaggacgtcagtggcatcgcctcc
tgcgtcttcaccaaatatggccaaggcttctacctgatctcaccctcggagtttgagcgc
ttctctctctccaccaagtggctggtggagccccggtgtctggtggattcagcagaaacc
aagaaccaccgccctggtaacggtgcgggccccaagaaggccccgagccgagccaggaac
tcagggactcagagtgatggcgaggagaagcagcccggcctggtgatggagcgcgctctg
ctcagtgatgagagagtcctgaaggaaatccagagcacactggagggagaccgcgggagc
ggcaactggcgttcacatcgagccgccgtggggtgcagcctcagcaatggcggagcagag
tga

DBGET integrated database retrieval system