KEGG   Homo sapiens (human): 3993Help
Entry
3993              CDS       T01001                                 

Gene name
LLGL2, HGL, Hugl-2, LGL2
Definition
(RefSeq) LLGL2, scribble cell polarity complex component
  KO
K06094  
lethal(2) giant larvae protein
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Tight junction
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    3993 (LLGL2)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    3993 (LLGL2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    3993 (LLGL2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    3993 (LLGL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6P1M3(Tbio)
UniProt: 
Position
17q25.1
AA seq 1020 aa AA seqDB search
MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYG
APGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLR
GPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQR
DGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIF
QGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEE
LVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEW
PIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFS
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQ
AVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFAD
TYLKDSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGIL
VLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEG
SRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIAS
CVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARN
SGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggttcctgaggccagggcatgaccctgtgcgggagaggctcaagcgggacctg
ttccagtttaacaagacggtggagcatggcttcccgcaccagcccagcgccctcggctac
agcccgtccctgcgcatcctggccatcggcacccgttctggagccatcaagctctacgga
gccccaggcgtggagttcatggggctgcaccaggagaacaacgctgtgacgcagatccac
ctcctgcccggccagtgccagctggtcaccctgctggatgacaacagcctgcacctttgg
agcctgaaggtcaagggcggggcatcggagctgcaggaggatgagagcttcacactgcgt
ggacccccaggggctgcccccagtgccacacagatcaccgtggtcctgccacattcctcc
tgcgagctgctctacctgggcaccgagagtggcaacgtgtttgtggtgcagctgccagct
tttcgtgcgctggaggaccggaccatcagctcggacgcggtgctgcagcggttgccagag
gaggcccgccaccggcgtgtgttcgagatggtggaggcactgcaggagcaccctcgagac
cccaaccagatcctgatcggctacagccgaggcctcgttgtcatctgggacctacagggc
agccgcgtgctctaccacttcctcagcagccagcaactggagaacatctggtggcagcgg
gacggccgcctgctcgtcagctgtcactctgacggcagctactgccagtggcccgtgtcc
agcgaagcccagcaaccagagcccctccgcagcctcgtgccttacggtccctttccttgc
aaagcgattaccagaatcctctggctgaccactaggcaggggttgcccttcaccatcttc
cagggtggcatgccacgggccagctacggggaccgccactgcatctcagtgatccacgat
ggccagcagacggccttcgacttcacctcccgtgtcatcggcttcactgtcctcacagag
gcagaccctgcagccacctttgacgacccctatgccctggtggtgctggctgaggaggag
ctggtggtgattgacctgcagacagcaggctggccaccggtccagctgccctacctggct
tctctgcactgttccgccatcacctgctctcaccacgtctccaacatcccgctgaagctg
tgggagcggatcattgccgccggcagccggcagaacgcacacttctccaccatggagtgg
ccaattgatggtggcaccagcctgaccccagccccaccccagagggacctgctgctcaca
gggcacgaggacggcacggtgcggttctgggatgcctcgggtgtctgcctgcggctgctc
tacaaactcagcactgtgcgcgtgttcctcaccgacacggaccccaacgagaacttcagt
gcccagggcgaggacgagtggcccccactccgcaaggtgggctcctttgacccctacagt
gatgacccccggctgggcatccagaagatcttcctctgcaagtacagcggctacctggct
gtggcaggcacggcagggcaggtgctggtactggaactgaatgacgaggcagcggagcag
gctgtggagcaggtggaggccgacctgctgcaggaccaagagggctaccgctggaagggg
cacgagcgcctggcagcccgctcagggcccgtgcgctttgagcctggctttcagcccttc
gtgttggtgcagtgtcagcccccggctgtggtcacctccttggccctgcactctgagtgg
cggctcgtggccttcggcaccagccatggctttggcctctttgaccaccagcagcggcgg
caggtctttgttaagtgcacactgcaccccagtgaccagctggccttggagggcccactc
tcccgcgtcaagtccctcaagaagtccttgcgtcagtcattccgccggatgcgtcggagc
cgggtgtccagccggaagcggcacccggctggccccccaggagaggcacaggaggggagt
gccaaggctgagcggccaggcctccagaacatggagctggcgcctgtgcagcgcaagatc
gaggctcgctcggcagaggactccttcacaggcttcgtccggaccctgtactttgctgac
acctacctgaaggacagctcccggcactgcccctcgctgtgggctggcaccaatgggggc
accatctatgccttctccctgcgtgtgcctcccgccgagcggagaatggatgagcctgtg
cgggcagagcaggccaaggagatccagctgatgcaccgggcgccggtggtgggcatcctg
gtgctcgacggacacagcgtaccccttcccgagcccctcgaagtggcccatgatctgtcg
aagagccctgacatgcagggaagccaccagctgctcgtcgtatcagaggagcagttcaag
gtgttcacgctgcccaaggtgagtgccaagctgaagttgaagctgacggccctggagggc
tcaagagtgcggcgggtcagcgtggcccacttcggcagtcgtcgagccgaggactacggg
gagcaccacctggcagtccttaccaacctgggcgacatccaggtggtctcgctgcccctg
ctcaagccccaggtgcgctacagctgcatccgccgggaggacgtcagtggcatcgcctcc
tgcgtcttcaccaaatatggccaaggcttctacctgatctcaccctcggagtttgagcgc
ttctctctctccaccaagtggctggtggagccccggtgtctggtggattcagcagaaacc
aagaaccaccgccctggtaacggtgcgggccccaagaaggccccgagccgagccaggaac
tcagggactcagagtgatggcgaggagaagcagcccggcctggtgatggagcgcgctctg
ctcagtgatgagagagtcctgaaggaaatccagagcacactggagggagaccgcgggagc
ggcaactggcgttcacatcgagccgccgtggggtgcagcctcagcaatggcggagcagag
tga

DBGET integrated database retrieval system