KEGG   Homo sapiens (human): 399664Help
Entry
399664            CDS       T01001                                 

Gene name
MEX3D, MEX-3D, MEX3, OK/SW-cl.4, RKHD1, RNF193, TINO
Definition
(RefSeq) mex-3 RNA binding family member D
  KO
K15686  
RNA-binding protein MEX3 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     399664 (MEX3D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     399664 (MEX3D)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    399664 (MEX3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q86XN8(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 651 aa AA seqDB search
MPSSLGQPDGGGGGGGGGGGVGAAGEDPGPGPAPPPEGAQEAAPAPRPPPEPDDAAAALR
LALDQLSALGLGGAGDTDEEGAAGDGAAAAGGADGGAAPEPVPPDGPEAGAPPTLAPAVA
PGSLPLLDPNASPPPPPPPRPSPPDVFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMT
ECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREI
LSAAEHFSIIRATRSKAGGLPGAAQGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQ
QRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRTGAFTDAGPDSDFHANGTD
VCLDLLGAAASLWAKTPNQGRRPPTATAGLRGDTALGAPSAPEAFYAGSRGGPSVPDPGP
ASPYSGSGNGGFAFGAEGPGAPVGTAAPDDCDFGFDFDFLALDLTVPAAATIWAPFERAA
PLPAFSGCSTVNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRLELPLSRRGAPDPVGA
LSWRPPQGPVSFPGGAAFSTATSLPSSPAAAACAPLDSGASENSRKPPSASSAPALAREC
VVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIHIFS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctcgctcggccagcccgacggcggcgggggcgggggcggcggcggcggcggc
gtgggggcggcgggggaggaccccggacccggacctgcgcccccgcccgagggcgcccag
gaggccgcgcccgcgccccggccgccgcccgaacccgacgacgcggccgccgcgctccgc
ctggcgctggaccagctgtcggcgctcgggctggggggcgctggcgacacggacgaggag
ggggcggccggggacggcgcagcggcggcggggggcgcggacggcggggcggctccggag
cctgtgccccccgacggacctgaggccggcgcgcccccgaccctggcccccgccgtggcc
cccgggtcgctgccgctgctggaccccaacgcgagtcccccgccgccgccgccgccccgg
ccgtcgccccccgacgtgttcgcgggcttcgcgccccaccccgcggccctggggcccccg
acgctgctggccgaccagatgagcgtgatcggcagccgcaagaaaagcgtcaacatgacc
gagtgcgtcccggtgcccagctccgagcacgtcgccgagatcgtgggtcgccagggctgc
aagatcaaggccctgcgggccaagacaaacacctacatcaagaccccagtgcggggcgag
gagccggtcttcatcgtgaccggccggaaggaggacgtggagatggccaagcgtgagatc
ctgtcggcggccgaacacttctccatcatccgcgccacgcgcagcaaggccgggggtctg
cccggcgccgcccagggcccgcccaaccttcccggacagaccaccatccaggtgcgcgtg
ccctaccgggtggtggggctggtggtggggcccaagggcgccaccatcaagcgcatccag
cagcggacgcacacctacatcgtgacgcccgggcgcgacaaggagccggtgttcgcggtc
actgggatgcccgagaacgtggaccgcgcgcgcgaggagatcgaggcgcacatcacgctg
cgcactggcgccttcaccgacgcgggccccgacagcgacttccacgccaacggcaccgac
gtctgcctggacctgctcggggcggccgccagcctctgggccaagacccccaaccaggga
cgacggccccccacggccacggccggcctccgcggggacacggccctgggcgcccccagc
gcccccgaggccttctacgcgggcagccgcggcggcccctccgtgccggacccaggcccc
gccagcccctacagcggctccggcaacgggggcttcgccttcggcgcggagggtcccggt
gccccggtggggacggccgcccccgacgactgcgacttcggcttcgacttcgacttcctg
gcgctggacctgaccgtgcccgccgcggccaccatctgggcgccttttgagcgcgccgcc
cccttgcccgccttcagcggctgctccacggtcaacggagccccgggacctcccgccgcc
ggcgcccggcgcagcagtggggccgggaccccccgccactcgcccacgctgcccgagccc
ggcggcctccgcctggagctcccgctgtctcgccgtggcgccccggacccggtgggcgcg
ctgtcctggcgacccccgcagggccccgtatccttcccaggcggcgccgccttctccacg
gccacctcgctgcccagcagccccgcggccgccgcctgcgcccccctggactccggcgcc
tccgagaacagccgcaagcccccttcggcgtcctcggccccggccctggcgcgagagtgc
gtggtgtgcgccgagggcgaggtgatggctgcgctggtcccctgcggccacaacctcttc
tgcatggactgcgccgtccgcatctgcggcaagagcgagcccgagtgtcccgcctgccgc
acgccggccacccaggccattcatatcttttcctag

DBGET integrated database retrieval system