KEGG   Homo sapiens (human): 4001Help
Entry
4001              CDS       T01001                                 

Gene name
LMNB1, ADLD, LMN, LMN2, LMNB
Definition
(RefSeq) lamin B1
  KO
K07611  lamin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Disease
H01230  Adult-onset autosomal dominant leukodystrophy (ADLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4001 (LMNB1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     4001 (LMNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament LTD Jnk-SapK_ap_N Spc7 IncA
Motif
Other DBs
NCBI-GeneID: 4001
NCBI-ProteinID: NP_005564
OMIM: 150340
HGNC: 6637
Ensembl: ENSG00000113368
Vega: OTTHUMG00000128969
Pharos: P20700(Tbio)
UniProt: P20700
Structure
PDB: 

Jmol
Position
5q23.2
AA seq 586 aa AA seqDB search
MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSAL
QLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLN
YAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAA
KKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEY
KLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI
ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDY
EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSV
SYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA
QRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcgacccccgtgccgccgcggatgggcagccgcgctggcggccccaccacg
ccgctgagccccacgcgcctgtcgcggctccaggagaaggaggagctgcgcgagctcaat
gaccggctggcggtgtacatcgacaaggtgcgcagcctggagacggagaacagcgcgctg
cagctgcaggtgacggagcgcgaggaggtgcgcggccgtgagctcaccggcctcaaggcg
ctctacgagaccgagctggccgacgcgcgacgcgcgctcgacgacacggcccgcgagcgc
gccaagctgcagatcgagctgggcaagtgcaaggcggaacacgaccagctgctcctcaac
tatgctaagaaggaatctgatcttaatggcgcccagatcaagcttcgagaatatgaagca
gcactgaattcgaaagatgcagctcttgctactgcacttggtgacaaaaaaagtttagag
ggagatttggaggatctgaaggatcagattgcccagttggaagcctccttagctgcagcc
aaaaaacagttagcagatgaaactttacttaaagtagatttggagaatcgttgtcagagc
cttactgaggacttggagtttcgcaaaagcatgtatgaagaggagattaacgagaccaga
aggaagcatgaaacgcgcttggtagaggtggattctgggcgtcaaattgagtatgagtac
aagctggcgcaagcccttcatgagatgagagagcaacatgatgcccaagtgaggctgtat
aaggaggagctggagcagacttaccatgccaaacttgagaatgccagactgtcatcagag
atgaatacttctactgtcaacagtgccagggaagaactgatggaaagccgcatgagaatt
gagagcctttcatcccagctttctaatctacagaaagagtctagagcatgtttggaaagg
attcaagaattagaggacttgcttgctaaagaaaaagacaactctcgtcgcatgctgaca
gacaaagagagagagatggcggaaataagggatcaaatgcagcaacagctgaatgactat
gaacagcttcttgatgtaaagttagccctggacatggaaatcagtgcttacaggaaactc
ttagaaggcgaagaagagaggttgaagctgtctccaagcccttcttcccgtgtgacagta
tcccgagcatcctcaagtcgtagtgtacgtacaactagaggaaagcggaagagggttgat
gtggaagaatcagaggcgagtagtagtgttagcatctctcattccgcctcagccactgga
aatgtttgcatcgaagaaattgatgttgatgggaaatttatccgcttgaagaacacttct
gaacaggatcaaccaatgggaggctgggagatgatcagaaaaattggagacacatcagtc
agttataaatatacctcaagatatgtgctgaaggcaggccagactgttacaatttgggct
gcaaacgctggtgtcacagccagccccccaactgacctcatctggaagaaccagaactcg
tggggcactggcgaagatgtgaaggttatattgaaaaattctcagggagaggaggttgct
caaagaagtacagtctttaaaacaaccatacctgaagaagaggaggaggaggaagaagca
gctggagtggttgttgaggaagaacttttccaccagcagggaaccccaagagcatccaat
agaagctgtgcaattatgtaa

DBGET integrated database retrieval system