KEGG   Homo sapiens (human): 4001Help
Entry
4001              CDS       T01001                                 

Gene name
LMNB1, ADLD, LMN, LMN2, LMNB
Definition
(RefSeq) lamin B1
  KO
K07611  
lamin B
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Disease
H01230  
Adult-onset autosomal dominant leukodystrophy (ADLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4001 (LMNB1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     4001 (LMNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23.2
AA seq 586 aa AA seqDB search
MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSAL
QLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLN
YAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAA
KKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEY
KLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI
ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDY
EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSV
SYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA
QRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcgacccccgtgccgccgcggatgggcagccgcgctggcggccccaccacg
ccgctgagccccacgcgcctgtcgcggctccaggagaaggaggagctgcgcgagctcaat
gaccggctggcggtgtacatcgacaaggtgcgcagcctggagacggagaacagcgcgctg
cagctgcaggtgacggagcgcgaggaggtgcgcggccgtgagctcaccggcctcaaggcg
ctctacgagaccgagctggccgacgcgcgacgcgcgctcgacgacacggcccgcgagcgc
gccaagctgcagatcgagctgggcaagtgcaaggcggaacacgaccagctgctcctcaac
tatgctaagaaggaatctgatcttaatggcgcccagatcaagcttcgagaatatgaagca
gcactgaattcgaaagatgcagctcttgctactgcacttggtgacaaaaaaagtttagag
ggagatttggaggatctgaaggatcagattgcccagttggaagcctccttagctgcagcc
aaaaaacagttagcagatgaaactttacttaaagtagatttggagaatcgttgtcagagc
cttactgaggacttggagtttcgcaaaagcatgtatgaagaggagattaacgagaccaga
aggaagcatgaaacgcgcttggtagaggtggattctgggcgtcaaattgagtatgagtac
aagctggcgcaagcccttcatgagatgagagagcaacatgatgcccaagtgaggctgtat
aaggaggagctggagcagacttaccatgccaaacttgagaatgccagactgtcatcagag
atgaatacttctactgtcaacagtgccagggaagaactgatggaaagccgcatgagaatt
gagagcctttcatcccagctttctaatctacagaaagagtctagagcatgtttggaaagg
attcaagaattagaggacttgcttgctaaagaaaaagacaactctcgtcgcatgctgaca
gacaaagagagagagatggcggaaataagggatcaaatgcagcaacagctgaatgactat
gaacagcttcttgatgtaaagttagccctggacatggaaatcagtgcttacaggaaactc
ttagaaggcgaagaagagaggttgaagctgtctccaagcccttcttcccgtgtgacagta
tcccgagcatcctcaagtcgtagtgtacgtacaactagaggaaagcggaagagggttgat
gtggaagaatcagaggcgagtagtagtgttagcatctctcattccgcctcagccactgga
aatgtttgcatcgaagaaattgatgttgatgggaaatttatccgcttgaagaacacttct
gaacaggatcaaccaatgggaggctgggagatgatcagaaaaattggagacacatcagtc
agttataaatatacctcaagatatgtgctgaaggcaggccagactgttacaatttgggct
gcaaacgctggtgtcacagccagccccccaactgacctcatctggaagaaccagaactcg
tggggcactggcgaagatgtgaaggttatattgaaaaattctcagggagaggaggttgct
caaagaagtacagtctttaaaacaaccatacctgaagaagaggaggaggaggaagaagca
gctggagtggttgttgaggaagaacttttccaccagcagggaaccccaagagcatccaat
agaagctgtgcaattatgtaa

DBGET integrated database retrieval system