KEGG   Homo sapiens (human): 4008Help
Entry
4008              CDS       T01001                                 

Gene name
LMO7, FBX20, FBXO20, LMO7b, LOMP
Definition
(RefSeq) LIM domain 7
  KO
K06084  
F-box protein 20
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    4008 (LMO7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     4008 (LMO7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8WWI1(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
13q22.2
AA seq 1631 aa AA seqDB search
MEGLEEAEANCSVAFAEAQRWVEAVTEKNFETKDFRASLENGVLLCDLINKLKPGVIKKI
NRLSTPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRVKNVLIT
LYWLGRKAQSNPYYNGPHLNLKAFENLLGQALTKALEDSSFLKRSGRDSGYGDIWCPERG
EFLAPPRHHKREDSFESLDSLGSRSLTSCSSDITLRGGREGFESDTDSEFTFKMQDYNKD
DMSYRRISAVEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEAD
GTFSSNQRRIWGTNVENWPTVQGTSKSSCYLEEEKAKTRSIPNIVKDDLYVRKLSPVMPN
PGNAFDQFLPKCWTPEDVNWKRIKRETYKPWYKEFQGFSQFLLLQALQTYSDDILSSETH
TKIDPTSGPRLITRRKNLSYAPGYRRDDLEMAALDPDLENDDFFVRKTGAFHANPYVLRA
FEDFRKFSEQDDSVERDIILQCREGELVLPDLEKDDMIVRRIPAQKKEVPLSGAPDRYHP
VPFPEPWTLPPEIQAKFLCVLERTCPSKEKSNSCRILVPSYRQKKDDMLTRKIQSWKLGT
TVPPISFTPGPCSEADLKRWEAIREASRLRHKKRLMVERLFQKIYGENGSKSMSDVSAED
VQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALE
KSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVE
EKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSPASLSSLRSRSTQMESTRV
SASLPRSYRKTDTVRLTSVVTPRPFGSQTRGISSLPRSYTMDDAWKYNGDVEDIKRTPNN
VVSTPAPSPDASQLASSLSSQKEVAATEEDVTRLPSPTSPFSSLSQDQAATSKATLSSTS
GLDLMSESGEGEISPQREVSRSQDQFSDMRISINQTPGKSLDFGFTIKWDIPGIFVASVE
AGSPAEFSQLQVDDEIIAINNTKFSYNDSKEWEEAMAKAQETGHLVMDVRRYGKAGSPET
KWIDATSGIYNSEKSSNLSVTTDFSESLQSSNIESKEINGIHDESNAFESKASESISLKN
LKRRSQFFEQGSSDSVVPDLPVPTISAPSRWVWDQEEERKRQERWQKEQDRLLQEKYQRE
QEKLREEWQRAKQEAERENSKYLDEELMVLSSNSMSLTTREPSLATWEATWSEGSKSSDR
EGTRAGEEERRQPQEEVVHEDQGKKPQDQLVIERERKWEQQLQEEQEQKRLQAEAEEQKR
PAEEQKRQAEIERETSVRIYQYRRPVDSYDIPKTEEASSGFLPGDRNKSRSTTELDDYST
NKNGNNKYLDQIGNMTSSQRRSKKEQVPSGAELERQQILQEMRKRTPLHNDNSWIRQRSA
SVNKEPVSLPGIMRRGESLDNLDSPRSNSWRQPPWLNQPTGFYASSSVQDFSRPPPQLVS
TSNRAYMRNPSSSVPPPSAGSVKTSTTGVATTQSPTPRSHSPSASQSGSQLRNRSVSGKR
ICSYCNNILGKGAAMIIESLGLCYHLHCFKCVACECDLGGSSSGAEVRIRNHQLYCNDCY
LRFKSGRPTAM
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atggaagggctggaggaggcagaggccaactgctccgtggcgttcgctgaggctcagaga
tgggtggaggcagtaacagagaagaattttgaaacaaaagattttcgagcctctctagaa
aatggtgttctgctgtgtgatttgattaataagcttaaacctggcgtcattaagaagatc
aatagactgtctacaccaatagcaggattggataatataaacgttttcttgaaagcttgt
gaacagattggattgaaagaagcccagcttttccatcctggagatctacaggatttatca
aatcgagtcactgtcaagcaagaagagactgacaggagagtgaaaaatgttttgataaca
ttgtactggctgggaagaaaagcacaaagcaacccgtactataatggtccccatcttaat
ttgaaagcgtttgagaatcttttaggacaagcactgacgaaggcactcgaagactccagc
ttcctgaaaagaagtggcagggacagtggctacggtgacatctggtgtcctgaacgtgga
gaatttcttgctcctccaaggcaccataagagagaagattcctttgaaagcttggactct
ttgggctcgaggtcattgacaagctgctcctctgatatcacgttgagaggggggcgtgaa
ggttttgaaagtgacacagattcggaatttacatttaagatgcaggattataataaagat
gatatgtcgtatcgaaggatttcggctgttgagccaaagactgcgttacccttcaatcgt
tttttacccaacaaaagtagacagccatcctatgtaccagcacctctgagaaagaaaaag
ccagacaaacatgaggataacagaagaagttgggcaagcccggtttatacagaagcagat
ggaacattttcaagtaatcagaggaggatttggggcaccaatgtggagaactggccaact
gtacaaggaacttcaaagtcctcttgttatttggaagaggaaaaagcaaagacaagaagc
atacccaacattgtaaaggatgatctttatgtgcgcaagctcagtccagtcatgccaaac
ccagggaatgcttttgatcagtttcttcccaaatgttggaccccagaagatgtgaactgg
aaaagaataaaaagggaaacttataagccatggtataaagaatttcagggattcagtcag
tttttactgcttcaggccctccaaacatactctgatgacatcttgtcttctgaaacacat
accaaaattgatcccacttctggcccaaggctcataacccgcaggaagaatctctcttat
gcaccaggctatagaagagatgacctcgagatggcagccctggatcctgacttagagaat
gatgatttctttgtcagaaagactggggctttccatgcaaatccatatgttctccgagct
tttgaagactttagaaagttctctgagcaagatgattctgtagagcgagatataatttta
cagtgtagagaaggtgaacttgtacttccggatttggaaaaagatgatatgattgttcgc
cgaattccagcacagaagaaagaagtgccgctgtctggggccccagatagataccaccca
gtcccttttcccgaaccctggactcttcctccagaaattcaagcaaaatttctctgtgta
cttgaaaggacatgcccatccaaagaaaaaagtaatagctgtagaatattagttccttca
tatcggcagaagaaagatgacatgctgacacgtaagattcagtcctggaaactgggaact
accgtgcctcccatcagtttcacccctggcccctgcagtgaggctgacttgaagagatgg
gaggccatccgggaggccagcagacttaggcacaagaaaaggctgatggtggagagactc
tttcaaaagatttatggtgagaatgggagtaagtccatgagtgatgtcagcgcagaagat
gttcaaaacttgcgtcagctgcgttacgaggagatgcagaaaataaaatcacaattaaaa
gaacaagatcagaaatggcaggatgaccttgcaaaatggaaagatcgtcgaaaaagttac
acttcagatctgcagaagaaaaaagaagagagagaagaaattgaaaagcaggcacttgag
aagtctaagagaagctctaagacgtttaaggaaatgctgcaggacagggaatcccaaaat
caaaagtctacagttccgtcaagaaggagaatgtattcttttgatgatgtgctggaggaa
ggaaagcgaccccctacaatgactgtgtcagaagcaagttaccagagtgagagagtagaa
gagaagggagcaacttatccttcagaaattcccaaagaagattctaccacttttgcaaaa
agagaggaccgtgtaacaactgaaattcagcttccttctcaaagtcctgtggaagaacaa
agcccagcctctttgtcttctctgcgttcacggagcacacaaatggaatcaactcgtgtt
tcagcttctctccccagaagttaccggaaaactgatacagtcaggttaacatctgtggtc
acaccaagaccctttggctctcagacaaggggaatctcatcactccccagatcttacacg
atggatgatgcttggaagtataatggagatgttgaagacattaagagaactccaaacaat
gtggtcagcacccctgcaccaagcccggacgcaagccaactggcttcaagcttatctagc
cagaaagaggtagcagcaacagaagaagatgtgacaaggctgccctctcctacatccccc
ttctcatctctttcccaagaccaggctgccacttctaaagccacattgtcttccacatct
ggtcttgatttaatgtctgaatctggagaaggggaaatctccccacaaagagaagtctca
agatcccaggatcagttcagtgatatgagaatcagcataaaccagacgcctgggaagagt
cttgactttgggtttacaataaaatgggatattcctgggatcttcgtagcatcagttgaa
gcaggtagcccagcagaattttctcagctacaagtagatgatgaaattattgctattaac
aacaccaagttttcatataacgattcaaaagagtgggaggaagccatggctaaggctcaa
gaaactggacacctagtgatggatgtgaggcgctatggaaaggctggttcacctgaaaca
aagtggattgatgcaacttctggaatttacaactcagaaaaatcttcaaatctatctgta
acaactgatttctccgaaagccttcagagttctaatattgaatccaaagaaatcaatgga
attcatgatgaaagcaatgcttttgaatcaaaagcatctgaatccatttctttgaaaaac
ttaaaaaggcgatcacaattttttgaacaaggaagctctgattcggtggttcctgatctt
ccagttccaaccatcagtgccccgagtcgctgggtgtgggatcaagaggaggagcggaag
cggcaggagaggtggcagaaggagcaggaccgcctactgcaggaaaaatatcaacgtgag
caggagaaactgagggaagagtggcaaagggccaaacaggaggcagagagagagaattcc
aagtacttggatgaggaactgatggtcctaagctcaaacagcatgtctctgaccacacgg
gagccctctcttgccacctgggaagctacctggagtgaagggtccaagtcttcagacaga
gaaggaacccgagcaggagaagaggagaggagacagccacaagaggaagttgttcatgag
gaccaaggaaagaagccgcaggatcagcttgttattgagagagagaggaaatgggagcaa
cagcttcaggaagagcaagagcaaaagcggcttcaggctgaggctgaggagcagaagcgt
cctgcggaggagcagaagcgccaggcagagatagagcgggaaacatcagtcagaatatac
cagtacaggaggcctgttgattcctatgatataccaaagacagaagaagcatcttcaggt
tttcttcctggtgacaggaataaatccagatctactactgaactggatgattactccaca
aataaaaatggaaacaataaatatttagaccaaattgggaacatgacctcttcacagagg
agatccaagaaagaacaagtaccatcaggagcagaattggagaggcaacaaatccttcag
gaaatgaggaagagaacaccccttcacaatgacaacagctggatccgacagcgcagtgcc
agtgtcaacaaagagcctgttagtcttcctgggatcatgagaagaggcgaatctttagat
aacctggactccccccgatccaattcttggagacagcctccttggctcaatcagcccaca
ggattctatgcttcttcctctgtgcaagactttagtcgcccaccacctcagctggtgtcc
acatcaaaccgtgcctacatgcggaacccctcctccagcgtgcccccaccttcagctggc
tccgtgaagacctccaccacaggtgtggccaccacacagtcccccaccccgagaagccat
tccccttcagcttcacagtcaggctctcagctgcgtaacaggtcagtcagtgggaagcgc
atatgctcctactgcaataacattctgggcaaaggagccgccatgatcatcgagtccctg
ggtctttgttatcatttgcattgttttaagtgtgttgcctgtgagtgtgacctcggaggc
tcttcctcaggagctgaagtcaggatcagaaaccaccaactgtactgcaacgactgctat
ctcagattcaaatctggacggccaaccgccatgtga

DBGET integrated database retrieval system